Felis catus (domestic cat): 101095522 Help Entry 101095522         CDS       T02385                                  Symbol PLA2G1B Name (RefSeq) phospholipase A2   KO K01047   secretory phospholipase A2 [EC:3.1.1.4] Organism fca  Felis catus (domestic cat) Pathway fca00564   Glycerophospholipid metabolism fca00565   Ether lipid metabolism fca00590   Arachidonic acid metabolism fca00591   Linoleic acid metabolism fca00592   alpha-Linolenic acid metabolism fca01100   Metabolic pathways fca04014   Ras signaling pathway fca04270   Vascular smooth muscle contraction fca04972   Pancreatic secretion fca04975   Fat digestion and absorption Brite KEGG Orthology (KO) [BR:fca00001]  09100 Metabolism   09103 Lipid metabolism    00564 Glycerophospholipid metabolism     101095522 (PLA2G1B)    00565 Ether lipid metabolism     101095522 (PLA2G1B)    00590 Arachidonic acid metabolism     101095522 (PLA2G1B)    00591 Linoleic acid metabolism     101095522 (PLA2G1B)    00592 alpha-Linolenic acid metabolism     101095522 (PLA2G1B)  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     101095522 (PLA2G1B)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     101095522 (PLA2G1B)   09154 Digestive system    04972 Pancreatic secretion     101095522 (PLA2G1B)    04975 Fat digestion and absorption     101095522 (PLA2G1B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101095522 (PLA2G1B) Enzymes [BR:fca01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.1  Carboxylic-ester hydrolases     3.1.1.4  phospholipase A2      101095522 (PLA2G1B) Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Centrosome formation proteins    Centriole proteins     101095522 (PLA2G1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phospholip_A2_1 Phospholip_A2_4 Phospholip_A2_2 Motif Other DBs NCBI-GeneID:  101095522 NCBI-ProteinID:  XP_019670179 UniProt:  A0A2I2ULG3 LinkDB All DBs Position D3:complement(16537846..16545786) Genome browser AA seq 148 aa AA seqDB search MKFLVLAALLTVGAAEGGVSPRAVWQLRNMIKCTIPESDPVRDYTDYGCYCGLGGSGTPV DELDKCCQTHDHCYSRAKKLDSCKFLLDNPYTKTYSYSCSGSEITCSDENKPCEAFICNC DRNAAICFSKAPYNKEHKNLDTKKYCKN NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atgaaattccttgtgctggctgctctgcttacagtgggtgctgctgaggggggcgtcagc ccgcgggcagtgtggcagctccgcaacatgatcaagtgtacgatccccgagagtgacccc gtgagggattacaccgactacggctgctactgtggcctgggtggatccggcacgcctgtg gatgaactggacaagtgttgccagacacacgaccactgctactcacgagccaagaaactg gacagctgcaaattcctcctggacaacccctacaccaaaacctactcatactcatgctct ggctctgagatcacctgcagcgatgaaaacaaaccctgtgaggccttcatctgcaactgc gaccgcaatgctgccatctgcttttcaaaggccccatataacaaggagcacaagaacctg gacaccaagaagtactgtaaaaattga

DBGET integrated database retrieval system