KEGG   Felis catus (domestic cat): 101095934
Entry
101095934         CDS       T02385                                 
Symbol
IRF3
Name
(RefSeq) interferon regulatory factor 3 isoform X1
  KO
K05411  interferon regulatory factor 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04936  Alcoholic liver disease
fca05133  Pertussis
fca05135  Yersinia infection
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05171  Coronavirus disease - COVID-19
fca05203  Viral carcinogenesis
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101095934 (IRF3)
   04621 NOD-like receptor signaling pathway
    101095934 (IRF3)
   04622 RIG-I-like receptor signaling pathway
    101095934 (IRF3)
   04623 Cytosolic DNA-sensing pathway
    101095934 (IRF3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101095934 (IRF3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101095934 (IRF3)
   05161 Hepatitis B
    101095934 (IRF3)
   05160 Hepatitis C
    101095934 (IRF3)
   05171 Coronavirus disease - COVID-19
    101095934 (IRF3)
   05164 Influenza A
    101095934 (IRF3)
   05162 Measles
    101095934 (IRF3)
   05168 Herpes simplex virus 1 infection
    101095934 (IRF3)
   05163 Human cytomegalovirus infection
    101095934 (IRF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101095934 (IRF3)
   05169 Epstein-Barr virus infection
    101095934 (IRF3)
   05165 Human papillomavirus infection
    101095934 (IRF3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101095934 (IRF3)
   05133 Pertussis
    101095934 (IRF3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101095934 (IRF3)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    101095934 (IRF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101095934 (IRF3)
   04131 Membrane trafficking [BR:fca04131]
    101095934 (IRF3)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    101095934 (IRF3)
Membrane trafficking [BR:fca04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    101095934 (IRF3)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 101095934
NCBI-ProteinID: XP_003997552
Ensembl: ENSFCAG00000006074
UniProt: M3W582
LinkDB
Position
E2:8347915..8353467
AA seq 420 aa
MGTQKPRILPWLKLQLDLGRLEGVAWLDESRTRFRIPWKHGLRQDAQQEDFGIFQAWAEA
SGAYIPGKDKPDLPTWKRNFRSALNRKEVLRLAEDRSKDPHDPHKVYEFVNSGAGDFPEL
DTSPDANSRCSPSDTQEDILEELLSDMALAPFPGGGPSSLPMVPEETPPFLLSPSVDIPA
PCPNLQPPENPLRRLLVPEEEWEFELTAFYRGRQVFQQTALCPGGLRLVASDADQTLPGQ
PIILPDPGVSLTDRGVMGYVRRVLSCLGGGLALWRAGQRLCARRLGHCHTYWALGEELLP
DSGHGPSGEVPKDEEGDVFDLKPFVAELIAFIEGSGHSPRYTLWFCVGEPWPQDQPWIKK
LVMVKVVPTCLRALLDMARSGGASSLETTVDLHISNSYPLSLTSDQYKAYLQDLVEDMDF
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgggtacccaaaagccgcggatcctgccctggctgaagttgcagctggacttggggcgg
ctggagggggtggcctggctggacgagagtcgcacgcgcttccgcatcccgtggaagcac
ggcttgcgccaggatgcccagcaggaggacttcggcatcttccaggcctgggccgaggcc
agcggcgcctacattcctggaaaggataaacctgatctgcccacctggaagaggaatttc
cgatcggccctgaaccggaaggaggtgttgcgtttagccgaggaccggagcaaggacccc
cacgacccccacaaggtctatgagtttgtgaactcaggagctggggactttcctgagttg
gacacctctccagatgccaatagcagatgcagtccctctgacacccaggaagacatactg
gaggagttactgagtgacatggccttggccccattcccaggtggggggccctcgagcctg
cctatggtccctgaggagacccctccattcttgctgagccccagcgtagacatccctgcc
ccctgcccaaacctgcagcccccggaaaatccactgaggcggctgttggtgcccgaggaa
gagtgggagttcgagctgactgccttctaccggggccgccaagtcttccagcagactgcc
ctctgcccgggaggcctgcggctggtggcgtcagatgcagaccagacgctgcctggacag
ccaataatcctgccagaccccggggtgtcgctgacggacaggggcgtgatgggctacgtg
aggcgtgtgctgagctgcctcggtggggggctagctctgtggagggcgggacagcggctc
tgcgcccggcggctggggcactgtcacacgtactgggccttgggcgaggagctcctccct
gacagtggccacgggcccagcggcgaggtccccaaggatgaggaaggagacgtgttcgac
ctgaagcccttcgtggcagaactgattgccttcattgaaggaagcggacactcaccacgc
tacaccctctggttctgcgttggggagccatggccccaggaccagccgtggatcaagaag
ctcgtgatggtcaaggttgttcccacttgtctcagggccctgctggacatggcacggtca
gggggcgcctcctcactggagaccaccgtggacctgcacatctccaacagctacccactc
tccctcacctcggaccagtacaaggcctacctccaggacctggtcgaagacatggatttc
tag

DBGET integrated database retrieval system