KEGG   Felis catus (domestic cat): 101095954
Entry
101095954         CDS       T02385                                 
Symbol
FYB1
Name
(RefSeq) LOW QUALITY PROTEIN: FYN-binding protein 1
  KO
K17698  FYN binding protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04015  Rap1 signaling pathway
fca05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101095954 (FYB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101095954 (FYB1)
SSDB
Motif
Pfam: hSH3 SH3_2 SH3_1 DUF4651 Asparaginase_2
Other DBs
NCBI-GeneID: 101095954
NCBI-ProteinID: XP_011284726
Ensembl: ENSFCAG00000008084
UniProt: M3W8Y2
LinkDB
Position
A1:210219239..210378524
AA seq 837 aa
MDTKADVKSLMAKFNTGGNPTEEVSVNSRPFKVAGQSSPSGVQAKKNLFNNQGSASPPAG
PSNVPRFGSPKPPLAVKPSSEEKPDKEPKPPFLKPTGVGQRFGPPANSATRDPEVKVGFP
KPVGPKPINVPKEDSKPVFPRPHGNKPLLHNVNEDHDLKPPGPKPGSNPPAQETEQKQVF
PKLAGVKGKFGSASQDHDPKPLLTKPVFGQKPSLSSDDSHEDENATKNASLQKGLPTPLG
AKSKMTPLKPTRHDEENKDQGGETSSSPFPGVVLKPAVNRGSPGLSKNAEEKKEDRKIDA
AKNVFLSKMNQEDPASGAPPAKFPKTPSKLTGAGPWGQSQEKEKGDKNSATPRQKPLPPL
FTLGPPPPKPSRPPNVDLTRFRKAASGNSTNKGQMCYSTTSLPPPPPSHPASQPPLPASH
PTQPPVPSLPPRNIKPPLDLKSAVHEENQDSVMHSDGTGNLDEEQESEGETYEDIEATKE
REKKREKEEKKRLELEKKEQKEREKKEQEIKKKFKLTGPIQVIHQAKACCDVKGGKNELS
FKQGEQIEIIRITDNPEGKWLGRTARGSYGYIKTTAVEIDYDSLRLKKSSLGALSSRPIG
DDQEVYDDVAEQDDISSHSQSGSGGMFPPPPDDDIYDGIEEEDTDDGSTLQVEEKSNSWS
WGILKMLKGKDDKKKSIREKPKVSESDNNEGSSFPAPPKQLDMGDEVYDDVDASDFPAPP
AELSQGAKAKTEEKDPKKLKKQEKEEKDFRKKFKYDGEIRVLYSTKVAPSLTSKRWGTRD
LQVKPGESLEVIQSTDDTKVLCRNEEGKYGYVLRSYLVDNDGEIYDDIADGCIYDND
NT seq 2514 nt   +upstreamnt  +downstreamnt
atggacacaaaagcagatgtgaagtccctcatggcgaagtttaacacggggggcaacccc
acggaggaggtctctgtcaacagccgccccttcaaagtcgcggggcaaagctcaccttca
ggagtacaagctaaaaagaacctattcaacaaccaaggaagtgccagccctcctgcggga
cctagcaacgtacctaggtttgggtccccaaagccacctttggcagtgaaaccttcatct
gaggagaagcccgacaaggagcccaagcccccgtttctaaagcctacgggagtgggccaa
agatttggaccaccggcaaactcagccaccagagaccctgaggtaaaagtgggatttcca
aaacctgtaggccccaagcccatcaatgtgcccaaagaagattccaaacctgtgtttccc
cggccccatgggaataagcctttgcttcacaatgtaaacgaagaccacgacctaaagcca
ccaggccccaagccgggctctaatcccccagcccaggaaactgagcagaagcaagtgttc
cccaagttggctggggttaaaggcaagtttgggtcagcctcccaagaccacgaccccaag
cccctcttaaccaagcccgtctttggccagaagccatccctgagtagtgatgacagccac
gaagacgagaacgccaccaagaacgcgtctctacagaaaggcctcccgaccccccttgga
gccaagtccaaaatgacccctttaaaaccaacaaggcatgacgaagaaaataaagaccag
ggaggagagacgtcaagttcacctttccctggcgtggttctgaaacctgccgtgaacaga
ggaagcccaggcctctccaaaaatgctgaggagaaaaaagaagataggaagatagatgct
gctaagaacgtcttcctgagcaaaatgaatcaggaggacccggcctctggggctcctcct
gccaagttccctaagacgccttctaagctgacaggggcagggccatggggccaaagtcag
gagaaggaaaagggagacaagaattcagccacccctaggcagaagcccctgcctcccctg
ttcaccctgggcccaccgccaccaaagcccagcagacccccaaatgttgacctgacgaga
ttccgcaaagccgcttctggaaacagtaccaacaaaggccaaatgtgttactcaactact
tccctcccaccacctccaccgtcccatccagccagccaaccaccattgccagcatctcac
ccaacacaaccgccagtcccaagtctacctcccagaaacattaagccacctttagatcta
aaaagcgctgtacatgaagaaaatcaagatagtgtcatgcactctgatggtactggaaac
ctagatgaggaacaagagagtgaaggagaaacctatgaagacatagaagcaaccaaagaa
agagagaaaaaaagggaaaaggaggaaaagaagagattagaactggagaaaaaggaacag
aaagagcgagaaaagaaagaacaagaaataaagaagaaatttaaactaacaggccctatt
caagtcatccatcaagcaaaagcttgctgtgatgtcaaaggaggaaagaatgaactgagc
ttcaagcaaggagagcaaattgaaataatccgcatcacagacaaccctgaaggaaaatgg
ctgggcagaaccgccagggggtcatacggctatattaaaacaactgccgtggagatcgac
tacgactccctgaggctgaagaaaagttctctcggtgctctttcatcaagaccgattgga
gatgaccaggaggtatatgatgacgtcgcagagcaggatgatattagcagccacagtcag
agtggaagtggagggatgttcccacctcccccagatgatgatatttacgatgggatcgaa
gaggaagatactgatgatggctccacactacaggttgaagagaagagtaattcgtggtcc
tgggggattttgaagatgttaaagggaaaagatgacaaaaagaaaagtatacgagagaaa
cctaaagtctctgagtcagacaataatgaaggttcatcttttcctgctcctcctaaacaa
ttggacatgggagatgaagtttatgatgatgtggatgcgtctgatttccctgctccacca
gcagagctgagtcaaggggccaaggctaagacagaagaaaaagaccccaagaagctaaaa
aagcaggaaaaagaagagaaagacttcaggaaaaagtttaaatatgatggtgaaattaga
gttttatattcaaccaaagttgcaccctccttaacttctaaaaggtgggggaccagagat
ctacaggtgaagcccggtgaatctctcgaagttatacaaagcactgatgatacgaaagtt
ctctgcaggaatgaagaagggaaatatggttatgttcttcggagttacttggtggataat
gatggagagatctatgatgatattgctgatggttgcatctatgacaatgactag

DBGET integrated database retrieval system