Felis catus (domestic cat): 101095993 Help Entry 101095993         CDS       T02385                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism fca  Felis catus (domestic cat) Pathway fca04010   MAPK signaling pathway fca04014   Ras signaling pathway fca04015   Rap1 signaling pathway fca04024   cAMP signaling pathway fca04062   Chemokine signaling pathway fca04510   Focal adhesion fca04520   Adherens junction fca04611   Platelet activation fca04670   Leukocyte transendothelial migration fca04720   Long-term potentiation fca04722   Neurotrophin signaling pathway fca04934   Cushing syndrome fca04972   Pancreatic secretion fca05211   Renal cell carcinoma fca05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101095993 (RAP1B)    04014 Ras signaling pathway     101095993 (RAP1B)    04015 Rap1 signaling pathway     101095993 (RAP1B)    04024 cAMP signaling pathway     101095993 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     101095993 (RAP1B)    04520 Adherens junction     101095993 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     101095993 (RAP1B)    04670 Leukocyte transendothelial migration     101095993 (RAP1B)    04062 Chemokine signaling pathway     101095993 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     101095993 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     101095993 (RAP1B)    04722 Neurotrophin signaling pathway     101095993 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     101095993 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101095993 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     101095993 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101095993 (RAP1B)    04031 GTP-binding proteins [BR:fca04031]     101095993 (RAP1B) Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101095993 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    101095993 (RAP1B)   Exosomal proteins of colorectal cancer cells    101095993 (RAP1B) GTP-binding proteins [BR:fca04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     101095993 (RAP1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  101095993 NCBI-ProteinID:  XP_023112985 LinkDB All DBs Position B4:93519185..93565176 Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKTRKKST CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagttgttcttggctcaggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggaacaatttaccgcaatgagggatttatacatgaaaaacggacaaggctttgcatta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagagcaaatt cttcgagttaaagacactgatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacaatggaacaat tgtgcattcttagaatcctccgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaagacccgcaaaaagtcaaca tgtcagctgctttaa

DBGET integrated database retrieval system