KEGG   Felis catus (domestic cat): 101096132
Entry
101096132         CDS       T02385                                 
Symbol
CD14
Name
(RefSeq) monocyte differentiation antigen CD14
  KO
K04391  monocyte differentiation antigen CD14
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04064  NF-kappa B signaling pathway
fca04145  Phagosome
fca04620  Toll-like receptor signaling pathway
fca04640  Hematopoietic cell lineage
fca04936  Alcoholic liver disease
fca05132  Salmonella infection
fca05133  Pertussis
fca05134  Legionellosis
fca05146  Amoebiasis
fca05152  Tuberculosis
fca05202  Transcriptional misregulation in cancer
fca05221  Acute myeloid leukemia
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101096132 (CD14)
   04064 NF-kappa B signaling pathway
    101096132 (CD14)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101096132 (CD14)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101096132 (CD14)
   04620 Toll-like receptor signaling pathway
    101096132 (CD14)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101096132 (CD14)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101096132 (CD14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101096132 (CD14)
   05133 Pertussis
    101096132 (CD14)
   05134 Legionellosis
    101096132 (CD14)
   05152 Tuberculosis
    101096132 (CD14)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101096132 (CD14)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101096132 (CD14)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    101096132 (CD14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101096132 (CD14)
   04090 CD molecules [BR:fca04090]
    101096132 (CD14)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
    101096132 (CD14)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   101096132 (CD14)
CD molecules [BR:fca04090]
 Proteins
  101096132 (CD14)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
 Receptors
  101096132 (CD14)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_6
Other DBs
NCBI-GeneID: 101096132
NCBI-ProteinID: XP_003980890
UniProt: M3VWC6
LinkDB
Position
A1:complement(118893796..118896042)
AA seq 375 aa
MVRAPCLLLLLLLLLPMLCVSETTPEPCEVDDDDVRCFCNFTDPQPDWSSAFQCMAAVEV
EIHGGGRSLEQFLKGADADPKQYADMVKALRLRRLTVGSAQVPAVLLVAFLRALSYSRLK
ELTLQNLEVTGAMPPLLLEATGPALSTLSLRNVSWATGGAWLAELQQWLKPGLKVLNIAQ
AHSLAFPCSQLRTFPALTTLDLSDNPGLGEDGLTAALCPHKFPALRALALRNAGMETPNG
VCVAMAAAGVQPHSLDLSHNSLRATAPGAPGCVWPSTLNSLNLSFAGLEQVPKGLPAKLS
VLDLRCNRLNRVPGLEELPKVSNLTLDGNPFMDPEAPKYQEDPMNSGVVQACARSALAVG
MSGTLAVLQRAGGFA
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggtgcgcgcgccctgcttgctgctgctgctgctgctgctgctgccaatgctgtgcgtc
tctgagaccacaccagaaccctgcgaagtggacgacgacgatgtccgctgcttctgcaac
ttcacggatcctcagcccgactggtccagcgccttccagtgtatggctgccgtcgaggtg
gagatccacggcggcggccgcagcctggaacaatttctaaagggcgcagacgccgacccg
aagcagtatgctgacatggtcaaggctctgcgcttgcggcggctcacagtgggctctgca
caggttcctgctgtgctgctggtcgccttcctgcgtgcgctctcatattcccgcctcaaa
gaactgacgctccagaacctggaggtaaccggcgcgatgccgccgcttcttctggaagcc
actgggcctgcgctctccaccctcagtctccggaacgtgtcgtgggcaaccggaggtgcc
tggctcgcggaactgcagcagtggctcaagccgggcctcaaagtactgaatattgcgcaa
gcacactcgcttgcttttccctgctcccaactccgcacctttccggccctcaccacctta
gatttatccgacaatcccggactgggcgaggacggactgactgcagctctttgtccgcac
aaattcccggcccttcgggctctggctttacgcaacgcggggatggagacgcccaacggc
gtgtgcgtggccatggcggcggcgggtgtgcaaccccacagcctagacctcagccacaac
tcgctgcgcgccaccgccccaggcgctcctggatgtgtctggcccagcacactgaactct
ctcaacttgtcgttcgctgggctggagcaggtgcctaagggactgccggccaagctcagc
gtgctagatcttaggtgcaacaggctgaacagagtgccggggctagaagagctgcccaag
gtgagtaacctgacactggacgggaatccctttatggaccctgaagcccccaaataccaa
gaagacccgatgaactctggcgtggtccaagcctgtgcgcgttcggccttggctgtgggg
atgtccggaaccctcgcggtgcttcaaagggcggggggcttcgcctaa

DBGET integrated database retrieval system