Felis catus (domestic cat): 101096604 Help Entry 101096604         CDS       T02385                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism fca  Felis catus (domestic cat) Pathway fca01523   Antifolate resistance fca04010   MAPK signaling pathway fca04014   Ras signaling pathway fca04024   cAMP signaling pathway fca04062   Chemokine signaling pathway fca04064   NF-kappa B signaling pathway fca04066   HIF-1 signaling pathway fca04071   Sphingolipid signaling pathway fca04137   Mitophagy - animal fca04151   PI3K-Akt signaling pathway fca04210   Apoptosis fca04211   Longevity regulating pathway fca04218   Cellular senescence fca04380   Osteoclast differentiation fca04613   Neutrophil extracellular trap formation fca04620   Toll-like receptor signaling pathway fca04621   NOD-like receptor signaling pathway fca04622   RIG-I-like receptor signaling pathway fca04623   Cytosolic DNA-sensing pathway fca04625   C-type lectin receptor signaling pathway fca04657   IL-17 signaling pathway fca04658   Th1 and Th2 cell differentiation fca04659   Th17 cell differentiation fca04660   T cell receptor signaling pathway fca04662   B cell receptor signaling pathway fca04668   TNF signaling pathway fca04722   Neurotrophin signaling pathway fca04917   Prolactin signaling pathway fca04920   Adipocytokine signaling pathway fca04926   Relaxin signaling pathway fca04931   Insulin resistance fca04932   Non-alcoholic fatty liver disease fca04933   AGE-RAGE signaling pathway in diabetic complications fca04936   Alcoholic liver disease fca05010   Alzheimer disease fca05022   Pathways of neurodegeneration - multiple diseases fca05030   Cocaine addiction fca05132   Salmonella infection fca05133   Pertussis fca05134   Legionellosis fca05135   Yersinia infection fca05140   Leishmaniasis fca05142   Chagas disease fca05145   Toxoplasmosis fca05146   Amoebiasis fca05152   Tuberculosis fca05160   Hepatitis C fca05161   Hepatitis B fca05162   Measles fca05163   Human cytomegalovirus infection fca05164   Influenza A fca05165   Human papillomavirus infection fca05166   Human T-cell leukemia virus 1 infection fca05167   Kaposi sarcoma-associated herpesvirus infection fca05168   Herpes simplex virus 1 infection fca05169   Epstein-Barr virus infection fca05170   Human immunodeficiency virus 1 infection fca05171   Coronavirus disease - COVID-19 fca05200   Pathways in cancer fca05202   Transcriptional misregulation in cancer fca05203   Viral carcinogenesis fca05207   Chemical carcinogenesis - receptor activation fca05208   Chemical carcinogenesis - reactive oxygen species fca05212   Pancreatic cancer fca05215   Prostate cancer fca05220   Chronic myeloid leukemia fca05221   Acute myeloid leukemia fca05222   Small cell lung cancer fca05235   PD-L1 expression and PD-1 checkpoint pathway in cancer fca05321   Inflammatory bowel disease fca05415   Diabetic cardiomyopathy fca05417   Lipid and atherosclerosis fca05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101096604 (RELA)    04014 Ras signaling pathway     101096604 (RELA)    04064 NF-kappa B signaling pathway     101096604 (RELA)    04668 TNF signaling pathway     101096604 (RELA)    04066 HIF-1 signaling pathway     101096604 (RELA)    04071 Sphingolipid signaling pathway     101096604 (RELA)    04024 cAMP signaling pathway     101096604 (RELA)    04151 PI3K-Akt signaling pathway     101096604 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     101096604 (RELA)   09143 Cell growth and death    04210 Apoptosis     101096604 (RELA)    04218 Cellular senescence     101096604 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101096604 (RELA)    04620 Toll-like receptor signaling pathway     101096604 (RELA)    04621 NOD-like receptor signaling pathway     101096604 (RELA)    04622 RIG-I-like receptor signaling pathway     101096604 (RELA)    04623 Cytosolic DNA-sensing pathway     101096604 (RELA)    04625 C-type lectin receptor signaling pathway     101096604 (RELA)    04660 T cell receptor signaling pathway     101096604 (RELA)    04658 Th1 and Th2 cell differentiation     101096604 (RELA)    04659 Th17 cell differentiation     101096604 (RELA)    04657 IL-17 signaling pathway     101096604 (RELA)    04662 B cell receptor signaling pathway     101096604 (RELA)    04062 Chemokine signaling pathway     101096604 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     101096604 (RELA)    04917 Prolactin signaling pathway     101096604 (RELA)    04926 Relaxin signaling pathway     101096604 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     101096604 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     101096604 (RELA)   09149 Aging    04211 Longevity regulating pathway     101096604 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101096604 (RELA)    05202 Transcriptional misregulation in cancer     101096604 (RELA)    05207 Chemical carcinogenesis - receptor activation     101096604 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     101096604 (RELA)    05203 Viral carcinogenesis     101096604 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101096604 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     101096604 (RELA)    05221 Acute myeloid leukemia     101096604 (RELA)    05220 Chronic myeloid leukemia     101096604 (RELA)    05215 Prostate cancer     101096604 (RELA)    05222 Small cell lung cancer     101096604 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101096604 (RELA)    05170 Human immunodeficiency virus 1 infection     101096604 (RELA)    05161 Hepatitis B     101096604 (RELA)    05160 Hepatitis C     101096604 (RELA)    05171 Coronavirus disease - COVID-19     101096604 (RELA)    05164 Influenza A     101096604 (RELA)    05162 Measles     101096604 (RELA)    05168 Herpes simplex virus 1 infection     101096604 (RELA)    05163 Human cytomegalovirus infection     101096604 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     101096604 (RELA)    05169 Epstein-Barr virus infection     101096604 (RELA)    05165 Human papillomavirus infection     101096604 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     101096604 (RELA)    05135 Yersinia infection     101096604 (RELA)    05133 Pertussis     101096604 (RELA)    05134 Legionellosis     101096604 (RELA)    05152 Tuberculosis     101096604 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     101096604 (RELA)    05145 Toxoplasmosis     101096604 (RELA)    05140 Leishmaniasis     101096604 (RELA)    05142 Chagas disease     101096604 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     101096604 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     101096604 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     101096604 (RELA)   09165 Substance dependence    05030 Cocaine addiction     101096604 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101096604 (RELA)    05418 Fluid shear stress and atherosclerosis     101096604 (RELA)    05415 Diabetic cardiomyopathy     101096604 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101096604 (RELA)    04932 Non-alcoholic fatty liver disease     101096604 (RELA)    04931 Insulin resistance     101096604 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     101096604 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     101096604 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:fca03000]     101096604 (RELA) Transcription factors [BR:fca03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     101096604 (RELA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  101096604 NCBI-ProteinID:  XP_023095836 UniProt:  A0A0D6CBM2 LinkDB All DBs Position D1:complement(108552124..108560648) Genome browser AA seq 555 aa AA seqDB search MDDLFPLIFPTEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLPPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSSAAVPKPAPQPYPFTPSLSTINF EEFSPMVFPSGQIPSQTPALAPAPAPILAPAPASVPAPAPVPAPAPAPAPAPAPILAPGL AQAVVPPAPKTTQAGEGTLTEALLHLQFDADEDLGALLGNSADPAVFTDLASVDNSEFQQ LLNQGVSVAPHPAEPMLMEYPEAITRLVTGSQRPPDPAPAPLGASGLPNGLLSGDEDFSS IADMDFSALLSQISS NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt atggacgacctgtttcccctcatcttcccgactgagccggcccaggcctctggcccttat gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggt cgctccgcaggcagtatccccggcgagaggagcacggataccaccaagacccaccccacc atcaagatcaatggctacaccgggccagggacagttcgcatctcattggtcaccaaggac ccccctcatcggcctcacccccatgagctggtgggaaaagactgccgggatggcttctat gaggctgagctctgcccagaccgctgcatccacagcttccagaacctggggatccagtgt gtaaagaagcgggacctggagcaggccatcagtcaacgtatccagaccaacaacaatccc ttccaagttcccatagaagaacagcgtggggactacgacctgaatgcggtgcggctctgc ttccaggtgacggtgcgggacccggcaggcaggcccctccgcttgccacctgtcctctcg catcccatctttgacaaccgtgcccccaacaccgccgagctcaagatctgccgagtgaac cgaaactctgggagctgcctcgggggggatgagatcttcctgctgtgtgacaaggtgcag aaagaggacatcgaagtgtatttcacgggaccaggctgggaggcccgaggctccttttct caagctgacgtacaccgacaagtggccattgtgttccggacacctccctatgccgacccc agcctgcaggcccccgtgcgtgtctccatgcagctgcggcggccttcagatcgggagctc agcgagcccatggaatttcagtacttgccagacacagatgatcgtcaccggattgaggag aaacgcaaaaggacatatgagaccttcaagagcatcatgaaaaagagtcctttcaatgga cccaccgacccccggcctccaccccggcgcattgctgtgccttcccgaagctcagctgcc gtccccaagccagctccccagccctatccctttacgccatccctcagcaccatcaacttc gaggagttctcccccatggtcttcccttccgggcagatcccaagccagacccctgccttg gcaccagcccctgccccaatcctggccccggcccctgcctctgtcccggcccctgcccct gtccccgcccctgccccggccccagccccggcccctgccccaatcttagccccaggcctt gctcaggctgtggtcccgcctgctcccaagaccacccaggctggggaagggacgctgacg gaggccctgctgcacctgcagtttgacgctgatgaagacctgggggccctgcttggcaac agcgccgacccagcagtgttcacagacctggcatccgtcgacaactctgagtttcagcag ctgctgaaccagggtgtatctgtggccccccacccagctgagcccatgctgatggaatac cctgaggcaataactcgcctggtgacgggatcccagaggccccctgacccagctcccgct cccctgggggcctctgggcttcccaacggcctcctctcaggggatgaagacttctcttcc attgccgacatggacttctcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system