KEGG   Felis catus (domestic cat): 101096625
Entry
101096625         CDS       T02385                                 
Symbol
BCAR1
Name
(RefSeq) breast cancer anti-estrogen resistance protein 1 isoform X3
  KO
K05726  breast cancer anti-estrogen resistance 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04015  Rap1 signaling pathway
fca04062  Chemokine signaling pathway
fca04510  Focal adhesion
fca04670  Leukocyte transendothelial migration
fca04810  Regulation of actin cytoskeleton
fca04935  Growth hormone synthesis, secretion and action
fca05100  Bacterial invasion of epithelial cells
fca05135  Yersinia infection
fca05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101096625 (BCAR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101096625 (BCAR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101096625 (BCAR1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    101096625 (BCAR1)
   04062 Chemokine signaling pathway
    101096625 (BCAR1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    101096625 (BCAR1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101096625 (BCAR1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101096625 (BCAR1)
   05100 Bacterial invasion of epithelial cells
    101096625 (BCAR1)
SSDB
Motif
Pfam: CAS_C Serine_rich SH3_1 SH3_9 SH3_2 Caskin1-CID
Other DBs
NCBI-GeneID: 101096625
NCBI-ProteinID: XP_011288551
Ensembl: ENSFCAG00000015361
LinkDB
Position
E2:complement(51863036..51900778)
AA seq 867 aa
MSVPNVLAKALYDNVAESPDELSFRKGDIMTVLERDTQGLDGWWLCSLHGRQGIVPGNRL
KILVGMHDKKPAGPGPGPPATSAQPQPGPHAPAAQYTPMLPATYQPQPDSVYLVPTPSKT
QQGLYQAPGPSPQFQSPPAKQTSMFSKQMPHHPFPSPAPDLYQVPPGPGSPAQDIYQVPP
SAGIGHDIYQVPPSMDARSWEGTKPPAKVVVPTRVGQGYVFEASQPEQDEYDIPRHLLAP
GPQDIYDVPPVRGLLPSQYGQEVYDTPPMAVKGPNGRDPSLDVYDVPPSVEKGLPLSNHH
AVYDVPPSVSKDVPDGPLLREETYDVPPAFAKAKPFDPTRHPLVLAAPPPDSLPAEDVYD
VPPPAPDLYDVPPGLRRPGPGTLYDVPRERLLPPEASDGGAADDTVYAVPPPAEREAPAD
GKRLSASSTGSTRSSQSASSLEAVVPGREPLELEAAVEALARLQQGVSASVAHLLDLAGG
IPACGGWRGASEPQEPPVQDLRAAVAAAQGAVHELLEFARGAIGNAAHTSDRTLHAKLGR
QLQKMEDVYQTLVAHGQALDGGRGGPGAAPEDLDRLVACSRAVPEDAKQLASFLHGNASL
LFRRTKAPVPGPEGGGSLHPNPIDKASSIQSRPLPSPPKFTSQDSPDGQYENSEGGWMED
YDYVHLQGKEEFEKTQKELLEKGNIMRQGKGQLELQQLKQFERLEQEVSRPIDHDLANWT
AAQPLAPGRPGGLGPSDRQLLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVAHSK
FVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSPAAA
QDMVDRVKELGHSTQQFRRVLGQLAAA
NT seq 2604 nt   +upstreamnt  +downstreamnt
atgtccgtgccgaacgtgctggccaaagccctctatgacaacgtggccgagtccccggat
gagctctccttccgcaagggtgacatcatgacggtgctggaacgggacacacagggcctg
gatggctggtggctctgctcgctgcatgggcgccaaggcattgtgcccgggaaccgcctt
aagatcctggtgggcatgcacgacaagaagccagcagggcccgggcctggcccacctgcc
acctcggcccagccccagcctggcccccacgccccggctgcccagtacacgcccatgctg
cctgccacataccagccccagcccgatagcgtgtacctggtgcccacccccagcaagact
cagcaaggcctctaccaagcccctggacccagcccacagttccagtctcccccagccaaa
cagacatctatgttctcaaagcagatgccccatcacccttttcccagcccagctccagac
ctttaccaggtgcccccagggcctggcagccccgcccaggatatttaccaggtgccacct
tctgctggcataggacatgacatctaccaggtgcccccatccatggatgcacgcagctgg
gaggggacgaagccaccggcaaaggtggtggtacccacccgtgtgggacagggctatgtg
ttcgaggcctcccagccagagcaggacgagtatgacatcccacgccacctgctagccccg
gggccccaggacatctacgacgtgccccctgttcgggggctgcttcccagccagtatggc
caggaggtatatgacacgccccccatggctgtcaagggtcctaatggccgggatccatcg
ctggatgtatatgatgtgccccccagtgtggagaagggcctgccgttgtccaaccaccat
gccgtgtatgacgttcctccgtcggtgagcaaggatgtgcctgacggcccactgctgcgt
gaggagacctatgacgtgccccccgcctttgccaaggccaagccctttgacccaacccgc
cacccgctggtcctcgccgcaccccctccggactcgctgccggctgaggatgtgtatgac
gtgccgccccccgctcctgacctctatgacgtaccccctggcttgcgacggcccggtccc
ggcaccctgtatgacgtgccccgtgagcggcttcttcctccagaggcgtccgatggcggc
gcggctgatgacaccgtatacgcggtgccgcccccggcggagcgggaggcccctgctgat
ggcaagcgcctgtcggcctccagtacgggcagcacacgcagcagccagtcggcctcctcc
ctggaggctgtggtgccgggtcgtgagcccctggagctggaggcggctgtggaggccctg
gcacggctgcagcagggcgtgagcgccagcgtggcgcacctcctggacctggcgggcggc
atccccgcgtgtggaggctggcgtggtgcctccgagcctcaggagccgccggtgcaggac
ctgcgggccgccgtggccgccgcccagggggctgtccatgagctgctggagtttgcccgc
ggtgccataggcaacgctgcccacacttctgaccgcacgctgcacgctaagcttggccgg
cagctgcagaagatggaggatgtgtaccagacgctggtggcccacggtcaggcccttgac
ggtggccggggaggcccgggggccgctcccgaagacctggaccgcctggtggcctgctca
cgggctgtgcccgaggacgccaagcagctggcctccttcctgcatggcaatgcctcgctg
ctcttcagacggaccaaggcccctgtcccggggcctgaggggggcggctccctgcacccc
aaccccatcgacaaggccagcagcatccagtcccggcccctgccctcacctcccaagttc
acctcccaggactcgccagatgggcagtatgagaacagtgaggggggctggatggaggat
tatgactacgtccatctacaggggaaggaagagtttgaaaagacccagaaggaactgctg
gaaaaaggcaacatcatgcggcaggggaagggccagctagagctgcagcagctgaagcag
tttgagcgactggagcaggaggtgtcgcggcccatcgaccacgacctggccaactggacg
gcggcccagcccctggccccagggcggccgggcggcctggggccctcggaccggcagctg
ctgctcttttacctggagcagtgcgaggcgaacctgaccaccctgaccaacgccgtggac
gccttcttcaccgccgtggccaccaaccagccgcccaagattttcgtggcgcacagcaag
ttcgtcatcctcagcgcccacaagctggtgttcatcggggacacgctgtcacggcaggcc
aaggcggctgacgtgcgcagccaggtgacccactacagcaacctgctgtgtgacctcctg
cgtggcatcgtcgccaccaccaaggctgccgccctgcagtacccgtcacccgccgccgcc
caggacatggtggacagggtcaaggagctggggcacagcacccagcagttccgccgggtc
ttgggccagctggccgccgcctga

DBGET integrated database retrieval system