KEGG   Felis catus (domestic cat): 101096739
Entry
101096739         CDS       T02385                                 
Symbol
TRAF3
Name
(RefSeq) TNF receptor-associated factor 3 isoform X1
  KO
K03174  TNF receptor-associated factor 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04064  NF-kappa B signaling pathway
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04668  TNF signaling pathway
fca04936  Alcoholic liver disease
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05171  Coronavirus disease - COVID-19
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05222  Small cell lung cancer
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101096739 (TRAF3)
   04668 TNF signaling pathway
    101096739 (TRAF3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101096739 (TRAF3)
   04621 NOD-like receptor signaling pathway
    101096739 (TRAF3)
   04622 RIG-I-like receptor signaling pathway
    101096739 (TRAF3)
   04657 IL-17 signaling pathway
    101096739 (TRAF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101096739 (TRAF3)
   05203 Viral carcinogenesis
    101096739 (TRAF3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101096739 (TRAF3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101096739 (TRAF3)
   05160 Hepatitis C
    101096739 (TRAF3)
   05171 Coronavirus disease - COVID-19
    101096739 (TRAF3)
   05164 Influenza A
    101096739 (TRAF3)
   05162 Measles
    101096739 (TRAF3)
   05168 Herpes simplex virus 1 infection
    101096739 (TRAF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101096739 (TRAF3)
   05169 Epstein-Barr virus infection
    101096739 (TRAF3)
   05165 Human papillomavirus infection
    101096739 (TRAF3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101096739 (TRAF3)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    101096739 (TRAF3)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 zf-C3HC4_2 MPS2 Cast Spc29 Tropomyosin_1 ATG16 KxDL Crescentin GAS FliJ Exonuc_VII_L zf-RING_6 DUF1664 T3SSipB BLOC1_2 SPATA24
Other DBs
NCBI-GeneID: 101096739
NCBI-ProteinID: XP_003988052
Ensembl: ENSFCAG00000010003
UniProt: A0A2I2UTY9
LinkDB
Position
B3:147054052..147180889
AA seq 568 aa
MEPSKKMESPGTLQTNPPLKLHPDRGAGTSVFVPEQGGYKERFVKTVEDKYKCEKCRLVL
CNPKQTECGHRFCETCMAALLSSSSPKCTACQEGIIKDKVFKDNCCKREILALQIYCRNE
GGGCTEQLTLGHLLVHLKNDCQFEELSCVRADCKEKVLRRDLRDHVEKACKYREATCSHC
KSQVPMITLQKHEDTECPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV
FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI
EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNR
VTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRG
EYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQ
TVLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1707 nt   +upstreamnt  +downstreamnt
atggagccaagtaaaaagatggaatcccccggcacactgcagacgaacccgccgctgaag
ctgcaccctgaccgcggcgccgggacgtccgtgttcgtccccgagcaaggaggttacaaa
gaaaggtttgtgaagaccgtggaggacaagtacaagtgcgagaagtgccgcctggtgctg
tgtaacccgaagcagacggagtgcggacaccggttctgtgagacctgcatggcggccctg
ctgagctcctccagcccaaaatgtaccgcgtgtcaagaaggcatcatcaaagataaggtg
tttaaggataattgctgcaagagagagattctggctcttcagatctactgcaggaacgag
ggcgggggctgcacggagcagttgaccctgggacacctgctggtgcatttaaagaatgat
tgccagtttgaagagctgtcgtgtgtccgcgctgactgcaaagagaaagtgttgagaaga
gacctgcgtgaccacgtggaaaaggcctgcaagtaccgggaggccacgtgcagccactgc
aaaagtcaggtcccgatgatcacgctgcagaaacacgaagacactgagtgtccctgtgtg
gtggtgtcctgcccccataagtgcagtgtccagacccttctgaggagtgagttgagtgcg
cacttgtcagagtgcgtcaatgcccccagcacctgtagttttaagcgctatggctgcgtg
tttcaggggacaaaccagcagattaaggcccatgaggccagctccgcggtgcagcacgtc
aacttactgaaagagtggagtaattctctggagaaaaaggtttccttgctacagaatgaa
agtgtagaaaaaaacaagagcatacaaagtctgcacaatcagatatgtagctttgaaatt
gaaattgagagacaaaaggaaatgcttcgaaacaatgaatccaaaatacttcatttacag
cgggtaatagacagccaggcggagaaattgaaagagcttgacaaagagatccgcccgttc
cggcagaactgggaagaagcggacagcatgaagagcagcgtggaatccctccagaaccga
gtgaccgagctggagagtgtggacaaaagcgccgggcaggcggctcggaacacaggcttg
ctggagtcccagctgagccggcacgaccagatgctgagcgtccacgacatccgcctggcc
gacatggatctgcgcttccaggttctggagaccgccagctacaatggcgtgctgatctgg
aagatccgagattacaagcggcggaagcaggaagccgtcatggggaagaccctgtccctt
tacagccagcctttctacacgggctattttggctataagatgtgtgccagggtctacctg
aacggggatggcatgggcaaggggacgcatctgtcgctgttttttgtcatcatgcgtgga
gaatacgatgctctgcttccttggccgttcaagcagaaagtgacactcatgctgatggat
caggggtcctctcggcgtcacctgggagacgcgttcaagccggaccccaacagcagcagc
ttcaagaaacccaccggggagatgaatatcgcctccggctgcccggtgtttgtggcccaa
actgtgctagaaaacgggacatatattaaagatgataccatttttattaaagtcatagtg
gatacttcggatctgcctgacccctga

DBGET integrated database retrieval system