KEGG   Felis catus (domestic cat): 101096863
Entry
101096863         CDS       T02385                                 
Symbol
NOD2
Name
(RefSeq) nucleotide-binding oligomerization domain-containing protein 2 isoform X1
  KO
K10165  nucleotide-binding oligomerization domain-containing protein 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04621  NOD-like receptor signaling pathway
fca04668  TNF signaling pathway
fca05152  Tuberculosis
fca05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101096863 (NOD2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101096863 (NOD2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101096863 (NOD2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101096863 (NOD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:fca04054]
    101096863 (NOD2)
Pattern recognition receptors [BR:fca04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   101096863 (NOD2)
SSDB
Motif
Pfam: NACHT CARD LRR_6 NLRC4_HD2 NOD2_WH LRR_4 AAA_16 AAA_29 NB-ARC LRR_8 AAA_22 AAA_30 AAA_25 ABC_tran
Other DBs
NCBI-GeneID: 101096863
NCBI-ProteinID: XP_019675297
Ensembl: ENSFCAG00000008505
LinkDB
Position
E2:30736746..30772710
AA seq 1020 aa
MTACYEMCTQEALQAQRSQLVGLLVSGSLEGFESILDWLLSWEVLSWEDYEGLSLLGQPL
SQLARCLLDTVWKKGAWGCEQLIAAVREAQTGCQAPELSCRWDPHSPHPAHDLQSHRPAI
VRRLYSHVEGVLDLAQERGFISRYECDEIRLPVFTSSQRARRLLDLATVKANGLAAFLLR
HVQELPVPVALPFGDAACEKYMSKLRTTLSAQSRFLSTYDGADNLCLEEVYTENVLEIRT
ELGVAGPPPKSPATLGLGELFSTCGHLNEDADTVLVVGEAGSGKSTLLQRVHLLWTTGRH
FREFLFVFPFSCRQLQRVAKPLSVQTLLFEHCCWPDVGRQDVFQFLLDHPNRVLLTFDGF
DEFRFRFTDRGERHCSPTDPTSVQNLLFNLLQGNLLKNARKVLTSRPDAVSALLRKYLRV
ELNLKGFSEEGIELYLRKRHREPGVADRLIRMLRATSALHGLCHLPVITWMVSKCHQELL
LPGGGSPRTTTGMYLLIVQHFLLRASPPDAAPRSPGPGLLRGRLPALLHLGWLALWGLGR
CCYVFSSRQLQAAHVDGDDVSLGFLVRAKSVAPGSVAPLEFLHITFQCFFAAFYLVLSAD
VPPSSLRRLFRCHTPGGSLLARLLPAACVRRPAREEGGVAALLQEAEPHNLQITAAFLAG
LLSREHRGLLAEGQASEKALLRRRVCARWCLSRSLHKHFHAIPPAVPGEAKSMHAMPGFV
WLSRSLYEMQEERLAREAVRGLKVGHLKLTFCGVGPAECAALAFVLRHLRRPVALQLDHN
SVGDVGVEQLLPCLDVCKALYLRDNNISDRGICKLVEHALHCEQLQKLALFNNKLTDGCA
HSVARLLACRQNFLALRLGNNHITASGAQVLAEGLRANASLQFLGFWGNKVGDEGAQALA
EALGDHQSLKWLSLVGNNIGSVGAQALALMLEKNVTLEELCLEENHLRDEGVCSLAKGLQ
RNSSLKVLKLSNNHITDLGAEVLLQALERNDTILEVWLRGNTFSPEETERLSQRDTRLLL
NT seq 3063 nt   +upstreamnt  +downstreamnt
atgacagcatgttatgagatgtgcacacaggaggctctccaggcgcagaggagccagctg
gtggggctgctggtctcggggtccctggagggcttcgagagcatcctggactggctgctt
tcctgggaagtcctctcctgggaagactacgagggcctcagcctcctgggccagcccctc
tcccagttggccaggtgcctcctggacactgtctggaagaagggtgcttggggctgtgaa
cagctcatcgcagctgtccgggaggcccagaccggctgtcaggctccggagctttcctgc
cgttgggatccccactcaccccacccagcgcatgacctgcagagtcaccggcccgccatc
gtcaggagactctacagccacgtggagggcgtgctggacctggcacaggagcggggtttc
atcagccggtatgaatgtgatgaaatcaggctgcctgttttcacgtcatcccagcgggca
agaaggctgctggatcttgcgaccgtgaaggcgaatgggttggccgccttccttctacga
catgttcaggaattgccagtcccggtggccctgcctttcggtgatgctgcgtgtgagaag
tacatgtccaagctgaggaccacgctatctgctcagtctcgtttcctgagcacctatgat
ggggcagacaatctttgcctggaggaagtatacacagagaatgttctggaaatccggaca
gagctgggcgtggccggccccccgccgaaaagccccgccaccctgggcctgggggaactc
ttcagcacctgtggccacctcaacgaggacgctgacaccgtgctggtggtgggcgaggcg
ggcagcggcaagagcactttgctgcagcgggtgcacttgctgtggaccacggggcgccac
ttccgggaattcctcttcgtcttcccattcagctgccggcagctgcagcgcgtggcaaag
ccgctgtccgtgcagacgctgctctttgaacactgctgttggcccgacgtcggccgccag
gacgtcttccagttcctccttgaccaccccaaccgcgtcctcttaaccttcgacggcttc
gacgagttcaggttcaggttcacggatcgcggcgagcgccactgctctccgaccgacccc
acgtcggtccagaatctgctgttcaacctactgcagggcaacctgctgaagaacgcccgc
aaggtgttgaccagccgtccggacgcggtgtcggctctcctcaggaagtacctgcgcgtg
gagctcaacctgaagggcttctcggaagagggcatcgaactgtacctgaggaagcgccac
cgcgagccgggggtggccgaccgcctcatccgcatgctcagagcgacctcagccctgcac
ggcttgtgccaccttcccgtcatcacgtggatggtgtccaaatgccaccaggaactgttg
ctgccgggcggggggtccccaaggaccaccacgggtatgtacctgctgatcgtgcagcat
tttctgctgcgcgcctccccgcccgacgcggccccccgcagcccggggcccgggctgctt
cgaggcaggctccccgcccttctgcacctcggctggctggctctctggggcctgggcagg
tgctgctacgtgttctcctccaggcagctccaggcggcacacgtcgacggcgacgacgtc
tctctcggcttcctggtgcgtgccaagagcgtcgcgcccgggagcgtcgcccccctggaa
ttcctgcacatcaccttccagtgcttcttcgccgccttctacctcgtgctcagcgccgac
gtgccaccgtcctcgctcagacgcctcttccgctgtcacacgccgggcggctcgctcctg
gccaggctgctgcccgcggcgtgcgtgcggcgcccggcgcgcgaggagggcggcgtggcg
gcgttgctccaggaggccgagccgcacaacctccagatcacggcggccttcctggcgggg
ctgctgtcccgggagcacaggggcctgctggccgagggccaggcgtccgagaaggccctg
ctccggcgccgggtctgcgcccggtggtgtctgtcgcgcagcctccacaaacactttcac
gccatccccccggccgtgcccggggaggccaagagcatgcacgccatgcccgggttcgtc
tggctcagccgcagcctgtacgagatgcaggaggagcgactggcgcgggaggccgtgcga
ggcctgaaggtcgggcacctcaagctgaccttttgcggcgtgggccccgcggaatgtgca
gccctggcgtttgtgctgcggcacctgcggcggcccgtggccctgcagctggaccacaac
tctgtcggtgacgttggtgtggagcagctgctgccttgtctcgacgtgtgcaaggctctt
tacttgcgagataacaatatctcagaccgaggcatctgcaagctcgtcgaacatgctctt
cactgtgagcagctgcagaagttagctctcttcaacaacaaactgaccgatggctgtgca
cactccgtggcgaggctccttgcgtgcaggcagaacttcttggctttgaggctgggcaat
aaccacatcactgcctcgggagcccaggtgctggctgaggggctcagagccaacgcctcc
ttgcagttcttggggttctggggcaacaaggtgggtgacgaaggggcccaggccttggct
gaagccttgggtgatcaccagagcttgaagtggctcagcctggtgggaaacaacatcggc
agtgtgggggctcaagccttagccttaatgttggaaaagaacgtgacactggaagaactc
tgcctggaggagaaccatctccgggatgaaggtgtgtgttctcttgccaaaggacttcag
aggaattcaagtttgaaagtcctaaagctgtccaacaaccacatcaccgaccttggagct
gaagtccttctgcaggccctggaaaggaatgataccatcctggaagtctggctccgaggc
aatactttctctccggaggagaccgagaggctcagccagagggacaccagactcttgctc
tga

DBGET integrated database retrieval system