KEGG   Felis catus (domestic cat): 101096892
Entry
101096892         CDS       T02385                                 
Symbol
AGER
Name
(RefSeq) advanced glycosylation end product-specific receptor isoform X3
  KO
K19722  receptor for advanced glycosylation end products
Organism
fca  Felis catus (domestic cat)
Pathway
fca04613  Neutrophil extracellular trap formation
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05010  Alzheimer disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05415  Diabetic cardiomyopathy
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101096892 (AGER)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101096892 (AGER)
   05022 Pathways of neurodegeneration - multiple diseases
    101096892 (AGER)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101096892 (AGER)
   05415 Diabetic cardiomyopathy
    101096892 (AGER)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101096892 (AGER)
SSDB
Motif
Pfam: C2-set_2 Ig_3 Ig_2 ig I-set V-set Izumo-Ig Ig_4 Ig_5 C2-set DUF6479 EphA2_TM
Other DBs
NCBI-GeneID: 101096892
NCBI-ProteinID: XP_003986017
Ensembl: ENSFCAG00000004529
LinkDB
Position
B2:complement(33081127..33084491)
AA seq 403 aa
MAAGAAAGAWVLVFSLWGAVVGDRNITARIGKPLVLNCRGAPKKPPQQLEWKLNTGRTEA
WKVLSPQGDPWDSVARVLPNGSLLLPAVGIQDEGTFRCRAKSRNGKETRSTYQVRVYQIP
GKPEIVDPASELMAGVPNKVGTCLSKGGYPAGTLNWHLDGKPLIPDGKGVSVQEETRRHP
ETGLFTLQSELMVTPARGGAPHPTFSCSFSPGLPRRRALHTAPIQLSVWEPVPLEVQLVV
EPEGGTVAPGGTVTLTCETPAQSSLQIHWIKDGVPLPLTPNPVLLLSEVRPQDQGTYSCV
ATHPSHGPQESRAVSVHIIETEEGPTAGPLEGQGLGTVALALGILGGLGIAALLIGAIIW
QRQRRQGEERKAPENQEEEEEEEREELNQSGEPEAAEGSAAGP
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggcagcaggggcagcagctggagcctgggtgctggtcttcagtctgtggggggcagta
gtaggcgaccgaaacatcacagcccggattgggaagccactggtgctgaactgtaggggg
gcccccaagaaaccaccccagcagttggaatggaaactgaacacaggccgaacagaagct
tggaaggtcctgtctccccagggagacccctgggatagtgtagctcgagtgctccccaat
ggctccctcctcctgccggcagtagggatccaggatgaggggactttccggtgccgggca
aaaagcaggaatggaaaggagacgaggtcaacctaccaagtccgagtctaccagattcct
gggaagccagaaatcgtggatcctgcctctgaactcatggctggtgtccccaataaggtg
gggacatgtttgtccaaggggggctaccctgccggaactcttaactggcacttggatggg
aaacccctcatacctgatggcaaaggagtgtccgtgcaggaagagaccaggagacaccct
gaaacagggcttttcacactccagtcagaactgatggtgaccccagcccggggaggagct
ccccatcccactttctcctgtagcttcagtcctggccttccccggcgccgagccctacac
acggcccccatccagctcagcgtctgggagcctgtgcctctggaggtccaattggtggta
gagccagaaggtggaacagtagctcctggtggtaccgtgaccctgacctgtgaaacccct
gcccagtcctcccttcaaatccactggatcaaggacggcgtgcccctgccccttaccccc
aaccctgtgttgctcctctctgaggtaagacctcaggaccagggaacctacagctgtgta
gccacccatcccagccatgggccccaggaaagccgtgctgtcagtgtccacatcatcgaa
acagaggaggggccaactgcaggtcctttggaagggcaggggctgggaactgtagcccta
gccctggggatcctgggaggcctggggatagctgccctgctcattggggccatcatatgg
caaagacagcgacgccaaggagaggagaggaaggccccagaaaaccaggaggaggaggag
gaggaggagcgcgaagagctgaatcagtcaggggagcctgaggcagctgagggcagtgca
gcagggccttga

DBGET integrated database retrieval system