KEGG   Felis catus (domestic cat): 101097059
Entry
101097059         CDS       T02385                                 
Name
(RefSeq) tyrosine-protein kinase ZAP-70 isoform X2
  KO
K07360  tyrosine-protein kinase ZAP-70 [EC:2.7.10.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04014  Ras signaling pathway
fca04064  NF-kappa B signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca05135  Yersinia infection
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101097059
   04064 NF-kappa B signaling pathway
    101097059
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101097059
   04660 T cell receptor signaling pathway
    101097059
   04658 Th1 and Th2 cell differentiation
    101097059
   04659 Th17 cell differentiation
    101097059
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101097059
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101097059
  09163 Immune disease
   05340 Primary immunodeficiency
    101097059
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101097059
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101097059
Protein kinases [BR:fca01001]
 Non-receptor tyrosine kinases
  SYK family
   101097059
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 ABC1 Haspin_kinase RIO1 Kdo
Other DBs
NCBI-GeneID: 101097059
NCBI-ProteinID: XP_011279356
Ensembl: ENSFCAG00000010410
LinkDB
Position
A3:complement(64648432..64671273)
AA seq 459 aa
MPWYHSSLTREEAERKLYSGSQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGK
YCIPEGTKFDTLWQLVEYLKLKADGLIYCLKDACPNSSASASAEAAAPTLPAHPSTFTHA
QRRIDTLNSDGYTPEPARLVSAEKPRPMPMDTSVYESPYSDPEELKDKKLFLKRENLLIA
DIELGCGNFGSVRQGVYRMRKKQIDVAIKVLKHSTEKTDKDEMMREAQIMHQLDNPYIVR
LIGVCQAEALMLVMEMAGGGPLHKFLLGKKEEIPISNVAELLHQVSMGMKYLEEKNFVHR
DLAARNVLLVNRHYAKISDFGLSKALGADDSYYTARSAGKWPLKWYAPECFNFRKFSSRS
DVWSYGVTMWEAFSYGQKPYKKMKGPEVIAFIEQGKRMECPPDCPPEMYTLMSDCWIYKW
EDRPDFLAVEQRMRTYYYSLASKTEDPPGPGKGTETAFA
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgccctggtaccacagcagcctgactcgagaggaggcagagcgcaaactctattcgggc
tcgcagaccgacggcaagttcctgctgaggccccggaaggagcagggcacgtacgcattg
tccctgatctacgggaaaaccgtataccactacctcatcagccaggacaaggcaggcaaa
tactgtattcctgaggggaccaagtttgacacgctctggcagctggtagagtacctgaag
ctgaaggctgatgggctcatctactgcctgaaggatgcctgccccaactccagcgccagc
gccagcgcagaggctgctgctcccacactcccagctcacccatccactttcacccatgct
cagagacggattgatacccttaactcagatggatacacccctgaaccagcacgcctagtg
tccgcagagaagccaaggccaatgcccatggacacaagtgtgtacgagagcccctacagt
gaccctgaggagctcaaggacaagaagctcttcctgaagcgtgagaaccttctcatcgct
gacatagaacttggctgtggcaactttggctcggtgcgccagggcgtctatcgcatgcgc
aagaagcagattgacgtcgccatcaaggtgttgaagcacagcacggagaagacagacaag
gatgagatgatgcgcgaggcgcagattatgcaccagctggacaacccctacatcgtgcgg
ctcatcggcgtctgccaggccgaggccctcatgctcgtcatggagatggcgggcggcggc
cccctgcacaagttcctgcttgggaagaaggaggagatccccatcagcaacgtggcggag
ctgctgcaccaggtgtccatggggatgaagtacctggaggagaaaaattttgtgcaccgt
gacctggcagcccgcaacgtcctgctggtcaaccggcactacgccaagatcagcgacttc
ggtctctccaaggcactgggtgccgacgacagctactatactgcccgctcagcagggaag
tggccgctcaagtggtatgcgcccgagtgtttcaacttccgcaagttctccagccgcagt
gatgtttggagctatggggtcaccatgtgggaggccttctcctatggccagaagccctac
aagaagatgaagggccctgaagtcatagccttcatcgagcagggcaagaggatggagtgc
ccgccggactgtccacctgaaatgtacacactcatgagtgactgctggatctacaagtgg
gaagaccgcccagacttcctggctgtggagcagcgcatgcggacctactattacagcttg
gcgagcaagactgaggaccccccggggcctggaaagggaaccgagactgcttttgcctga

DBGET integrated database retrieval system