Felis catus (domestic cat): 101097261 Help Entry 101097261         CDS       T02385                                  Symbol JUN Name (RefSeq) transcription factor AP-1   KO K04448   transcription factor AP-1 Organism fca  Felis catus (domestic cat) Pathway fca01522   Endocrine resistance fca04010   MAPK signaling pathway fca04012   ErbB signaling pathway fca04024   cAMP signaling pathway fca04137   Mitophagy - animal fca04210   Apoptosis fca04310   Wnt signaling pathway fca04380   Osteoclast differentiation fca04510   Focal adhesion fca04530   Tight junction fca04620   Toll-like receptor signaling pathway fca04621   NOD-like receptor signaling pathway fca04625   C-type lectin receptor signaling pathway fca04657   IL-17 signaling pathway fca04658   Th1 and Th2 cell differentiation fca04659   Th17 cell differentiation fca04660   T cell receptor signaling pathway fca04662   B cell receptor signaling pathway fca04668   TNF signaling pathway fca04722   Neurotrophin signaling pathway fca04912   GnRH signaling pathway fca04915   Estrogen signaling pathway fca04921   Oxytocin signaling pathway fca04926   Relaxin signaling pathway fca04932   Non-alcoholic fatty liver disease fca04933   AGE-RAGE signaling pathway in diabetic complications fca05030   Cocaine addiction fca05031   Amphetamine addiction fca05132   Salmonella infection fca05133   Pertussis fca05135   Yersinia infection fca05140   Leishmaniasis fca05142   Chagas disease fca05161   Hepatitis B fca05162   Measles fca05166   Human T-cell leukemia virus 1 infection fca05167   Kaposi sarcoma-associated herpesvirus infection fca05169   Epstein-Barr virus infection fca05170   Human immunodeficiency virus 1 infection fca05171   Coronavirus disease - COVID-19 fca05200   Pathways in cancer fca05203   Viral carcinogenesis fca05207   Chemical carcinogenesis - receptor activation fca05208   Chemical carcinogenesis - reactive oxygen species fca05210   Colorectal cancer fca05211   Renal cell carcinoma fca05224   Breast cancer fca05231   Choline metabolism in cancer fca05235   PD-L1 expression and PD-1 checkpoint pathway in cancer fca05321   Inflammatory bowel disease fca05323   Rheumatoid arthritis fca05417   Lipid and atherosclerosis fca05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101097261 (JUN)    04012 ErbB signaling pathway     101097261 (JUN)    04310 Wnt signaling pathway     101097261 (JUN)    04668 TNF signaling pathway     101097261 (JUN)    04024 cAMP signaling pathway     101097261 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     101097261 (JUN)   09143 Cell growth and death    04210 Apoptosis     101097261 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101097261 (JUN)    04530 Tight junction     101097261 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101097261 (JUN)    04621 NOD-like receptor signaling pathway     101097261 (JUN)    04625 C-type lectin receptor signaling pathway     101097261 (JUN)    04660 T cell receptor signaling pathway     101097261 (JUN)    04658 Th1 and Th2 cell differentiation     101097261 (JUN)    04659 Th17 cell differentiation     101097261 (JUN)    04657 IL-17 signaling pathway     101097261 (JUN)    04662 B cell receptor signaling pathway     101097261 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     101097261 (JUN)    04915 Estrogen signaling pathway     101097261 (JUN)    04921 Oxytocin signaling pathway     101097261 (JUN)    04926 Relaxin signaling pathway     101097261 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     101097261 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     101097261 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101097261 (JUN)    05207 Chemical carcinogenesis - receptor activation     101097261 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     101097261 (JUN)    05203 Viral carcinogenesis     101097261 (JUN)    05231 Choline metabolism in cancer     101097261 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101097261 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     101097261 (JUN)    05211 Renal cell carcinoma     101097261 (JUN)    05224 Breast cancer     101097261 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101097261 (JUN)    05170 Human immunodeficiency virus 1 infection     101097261 (JUN)    05161 Hepatitis B     101097261 (JUN)    05171 Coronavirus disease - COVID-19     101097261 (JUN)    05162 Measles     101097261 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     101097261 (JUN)    05169 Epstein-Barr virus infection     101097261 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     101097261 (JUN)    05135 Yersinia infection     101097261 (JUN)    05133 Pertussis     101097261 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     101097261 (JUN)    05142 Chagas disease     101097261 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     101097261 (JUN)    05321 Inflammatory bowel disease     101097261 (JUN)   09165 Substance dependence    05030 Cocaine addiction     101097261 (JUN)    05031 Amphetamine addiction     101097261 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101097261 (JUN)    05418 Fluid shear stress and atherosclerosis     101097261 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     101097261 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     101097261 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     101097261 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:fca03000]     101097261 (JUN) Transcription factors [BR:fca03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     101097261 (JUN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 FlaC_arch NBP1 TFIIA Fib_alpha DUF3450 Motif Other DBs NCBI-GeneID:  101097261 NCBI-ProteinID:  XP_011283269 LinkDB All DBs Position C1:complement(48184876..48186916) Genome browser AA seq 334 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASAAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag tccgagagcggtgcctacggctacagtaaccccaagatcctgaaacagagcatgaccctg aacctggccgacccggtgggcagcctgaagccgcacctccgggccaagaactcggacctc ctcacctcgcccgacgtggggctgctcaagctggcctcgcccgagctggagcgcctgata atccagtccagcaacgggcacatcaccaccacgccgacccccacgcagttcctgtgcccc aagaacgtgacagacgagcaggagggcttcgccgagggtttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcagcggggcg ggcatggtggctccggcggtggcttcggcggcgggcggcagcggcagcggtggcttcagc gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaacccgggcgct ctgagcagcggcggtggggcgccctcctacggcgcggccggcctggcctttcccgcgcag ccccagcagcagcagcagcccccgcagccgccgcaccacctgccccagcagatccccgtg cagcacccgcggctgcaggccctgaaggaggagccgcagacggtgcccgagatgcccggg gaaacgccgcccctgtcccccatcgacatggagtcgcaggagaggatcaaggcggagagg aagcgcatgaggaaccgcatcgctgcctccaagtgccggaaaaggaagctggagaggatc gcccggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccacg gccaatatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

Felis catus (domestic cat): 493935 Help Entry 493935            CDS       T02385                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism fca  Felis catus (domestic cat) Pathway fca01522   Endocrine resistance fca04010   MAPK signaling pathway fca04024   cAMP signaling pathway fca04210   Apoptosis fca04380   Osteoclast differentiation fca04620   Toll-like receptor signaling pathway fca04657   IL-17 signaling pathway fca04658   Th1 and Th2 cell differentiation fca04659   Th17 cell differentiation fca04660   T cell receptor signaling pathway fca04662   B cell receptor signaling pathway fca04668   TNF signaling pathway fca04713   Circadian entrainment fca04725   Cholinergic synapse fca04728   Dopaminergic synapse fca04915   Estrogen signaling pathway fca04917   Prolactin signaling pathway fca04921   Oxytocin signaling pathway fca04926   Relaxin signaling pathway fca04928   Parathyroid hormone synthesis, secretion and action fca04932   Non-alcoholic fatty liver disease fca04935   Growth hormone synthesis, secretion and action fca05031   Amphetamine addiction fca05132   Salmonella infection fca05133   Pertussis fca05135   Yersinia infection fca05140   Leishmaniasis fca05142   Chagas disease fca05161   Hepatitis B fca05162   Measles fca05166   Human T-cell leukemia virus 1 infection fca05167   Kaposi sarcoma-associated herpesvirus infection fca05170   Human immunodeficiency virus 1 infection fca05171   Coronavirus disease - COVID-19 fca05200   Pathways in cancer fca05207   Chemical carcinogenesis - receptor activation fca05208   Chemical carcinogenesis - reactive oxygen species fca05210   Colorectal cancer fca05224   Breast cancer fca05231   Choline metabolism in cancer fca05235   PD-L1 expression and PD-1 checkpoint pathway in cancer fca05323   Rheumatoid arthritis fca05417   Lipid and atherosclerosis fca05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     493935 (FOS)    04668 TNF signaling pathway     493935 (FOS)    04024 cAMP signaling pathway     493935 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     493935 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     493935 (FOS)    04660 T cell receptor signaling pathway     493935 (FOS)    04658 Th1 and Th2 cell differentiation     493935 (FOS)    04659 Th17 cell differentiation     493935 (FOS)    04657 IL-17 signaling pathway     493935 (FOS)    04662 B cell receptor signaling pathway     493935 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     493935 (FOS)    04917 Prolactin signaling pathway     493935 (FOS)    04921 Oxytocin signaling pathway     493935 (FOS)    04926 Relaxin signaling pathway     493935 (FOS)    04935 Growth hormone synthesis, secretion and action     493935 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     493935 (FOS)   09156 Nervous system    04725 Cholinergic synapse     493935 (FOS)    04728 Dopaminergic synapse     493935 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     493935 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     493935 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     493935 (FOS)    05207 Chemical carcinogenesis - receptor activation     493935 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     493935 (FOS)    05231 Choline metabolism in cancer     493935 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     493935 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     493935 (FOS)    05224 Breast cancer     493935 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     493935 (FOS)    05170 Human immunodeficiency virus 1 infection     493935 (FOS)    05161 Hepatitis B     493935 (FOS)    05171 Coronavirus disease - COVID-19     493935 (FOS)    05162 Measles     493935 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     493935 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     493935 (FOS)    05135 Yersinia infection     493935 (FOS)    05133 Pertussis     493935 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     493935 (FOS)    05142 Chagas disease     493935 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     493935 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     493935 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     493935 (FOS)    05418 Fluid shear stress and atherosclerosis     493935 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     493935 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     493935 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:fca03000]     493935 (FOS)    04131 Membrane trafficking [BR:fca04131]     493935 (FOS) Transcription factors [BR:fca03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     493935 (FOS) Membrane trafficking [BR:fca04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     493935 (FOS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ Motif Other DBs NCBI-GeneID:  493935 NCBI-ProteinID:  NP_001009341 Ensembl:  ENSFCAG00000025370 UniProt:  Q8HZP6 LinkDB All DBs Position B3:122573803..122577106 Genome browser AA seq 381 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDNLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPAPSAGAYSRAGVVKTVTAGGR AQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSAL QTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAF TLPLLNDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFY AADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCGAAHR KGSSSNEPSSDSLSSPTLLAL NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt atgatgttctctggcttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcc tccccggccggggacaatctctcctactaccactcaccggccgactccttctccagcatg ggctctcctgtcaatgcgcaggacttctgcacggatctggccgtctccagcgccaacttt atcccaacggtgactgccatctccaccagcccggacctgcagtggctggtgcagcccacc ctggtctcctccgtggctccttcccagaccagagccccccacccctatggagtccccgcc ccctccgccggggcttactccagggccggagtcgtgaagaccgtgaccgcaggaggccga gctcagagcattggcaggaggggcaaagtggaacagttgtccccagaagaagaagagaaa aggagaatccgaagggaaaggaataagatggctgcagccaagtgccggaaccggaggcgg gagctcacggatacactccaagcggagacagatcaactagaagatgagaagtctgctttg cagactgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcagct caccgacccgcctgcaagatccccgatgacctgggcttcccggaagagatgtctgtggct tccctagatctgagcgggggcctgccggaagctgccacccccgagtcggaggaggctttc accctgcccctcctcaatgatcctgagcccaagccctccgtagagccggtcaagagcatc agcagcatggagctgaaggccgagcccttcgatgacttcctgttcccagcatcgtccagg cccagcggctccgagaccgcccgctctgtgccagacatggacctgtctggttccttctat gcagcagactgggagcccctgcatggtggctccctggggatggggcccatggccacagag ctggagcctctgtgcaccccggtggtcacctgtactcctagctgcactacttacacgtct tccttcgtcttcacctaccctgaggctgactccttccccagctgtggggctgctcaccgc aagggcagcagcagcaacgaaccctcctctgactcgctcagctcacccacgctgctggcc ctgtga

DBGET integrated database retrieval system