KEGG   Felis catus (domestic cat): 101097261
Entry
101097261         CDS       T02385                                 
Symbol
JUN
Name
(RefSeq) transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04024  cAMP signaling pathway
fca04137  Mitophagy - animal
fca04210  Apoptosis
fca04310  Wnt signaling pathway
fca04380  Osteoclast differentiation
fca04510  Focal adhesion
fca04530  Tight junction
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04668  TNF signaling pathway
fca04722  Neurotrophin signaling pathway
fca04912  GnRH signaling pathway
fca04915  Estrogen signaling pathway
fca04921  Oxytocin signaling pathway
fca04926  Relaxin signaling pathway
fca04932  Non-alcoholic fatty liver disease
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05030  Cocaine addiction
fca05031  Amphetamine addiction
fca05132  Salmonella infection
fca05133  Pertussis
fca05135  Yersinia infection
fca05140  Leishmaniasis
fca05142  Chagas disease
fca05161  Hepatitis B
fca05162  Measles
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05171  Coronavirus disease - COVID-19
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05207  Chemical carcinogenesis - receptor activation
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05210  Colorectal cancer
fca05211  Renal cell carcinoma
fca05224  Breast cancer
fca05231  Choline metabolism in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05321  Inflammatory bowel disease
fca05323  Rheumatoid arthritis
fca05417  Lipid and atherosclerosis
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101097261 (JUN)
   04012 ErbB signaling pathway
    101097261 (JUN)
   04310 Wnt signaling pathway
    101097261 (JUN)
   04668 TNF signaling pathway
    101097261 (JUN)
   04024 cAMP signaling pathway
    101097261 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101097261 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    101097261 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101097261 (JUN)
   04530 Tight junction
    101097261 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101097261 (JUN)
   04621 NOD-like receptor signaling pathway
    101097261 (JUN)
   04625 C-type lectin receptor signaling pathway
    101097261 (JUN)
   04660 T cell receptor signaling pathway
    101097261 (JUN)
   04658 Th1 and Th2 cell differentiation
    101097261 (JUN)
   04659 Th17 cell differentiation
    101097261 (JUN)
   04657 IL-17 signaling pathway
    101097261 (JUN)
   04662 B cell receptor signaling pathway
    101097261 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101097261 (JUN)
   04915 Estrogen signaling pathway
    101097261 (JUN)
   04921 Oxytocin signaling pathway
    101097261 (JUN)
   04926 Relaxin signaling pathway
    101097261 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101097261 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101097261 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101097261 (JUN)
   05207 Chemical carcinogenesis - receptor activation
    101097261 (JUN)
   05208 Chemical carcinogenesis - reactive oxygen species
    101097261 (JUN)
   05203 Viral carcinogenesis
    101097261 (JUN)
   05231 Choline metabolism in cancer
    101097261 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101097261 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101097261 (JUN)
   05211 Renal cell carcinoma
    101097261 (JUN)
   05224 Breast cancer
    101097261 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101097261 (JUN)
   05170 Human immunodeficiency virus 1 infection
    101097261 (JUN)
   05161 Hepatitis B
    101097261 (JUN)
   05171 Coronavirus disease - COVID-19
    101097261 (JUN)
   05162 Measles
    101097261 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101097261 (JUN)
   05169 Epstein-Barr virus infection
    101097261 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101097261 (JUN)
   05135 Yersinia infection
    101097261 (JUN)
   05133 Pertussis
    101097261 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101097261 (JUN)
   05142 Chagas disease
    101097261 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101097261 (JUN)
   05321 Inflammatory bowel disease
    101097261 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    101097261 (JUN)
   05031 Amphetamine addiction
    101097261 (JUN)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101097261 (JUN)
   05418 Fluid shear stress and atherosclerosis
    101097261 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101097261 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101097261 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101097261 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101097261 (JUN)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    101097261 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha FlaC_arch DUF3450 TFIIA NYD-SP28_assoc
Other DBs
NCBI-GeneID: 101097261
NCBI-ProteinID: XP_011283269
EnsemblRapid: ENSFCTG00005028512
LinkDB
Position
C1:complement(47857937..47860679)
AA seq 334 aa
MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGMVAPAVASAAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG
ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST
ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag
tccgagagcggtgcctacggctacagtaaccccaagatcctgaaacagagcatgaccctg
aacctggccgacccggtgggcagcctgaagccgcacctccgggccaagaactcggacctc
ctcacctcgcccgacgtggggctgctcaagctggcctcgcccgagctggagcgcctgata
atccagtccagcaacgggcacatcaccaccacgccgacccccacgcagttcctgtgcccc
aagaacgtgacagacgagcaggagggcttcgccgagggtttcgtgcgcgccctggccgaa
ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcagcggggcg
ggcatggtggctccggcggtggcttcggcggcgggcggcagcggcagcggtggcttcagc
gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaacccgggcgct
ctgagcagcggcggtggggcgccctcctacggcgcggccggcctggcctttcccgcgcag
ccccagcagcagcagcagcccccgcagccgccgcaccacctgccccagcagatccccgtg
cagcacccgcggctgcaggccctgaaggaggagccgcagacggtgcccgagatgcccggg
gaaacgccgcccctgtcccccatcgacatggagtcgcaggagaggatcaaggcggagagg
aagcgcatgaggaaccgcatcgctgcctccaagtgccggaaaaggaagctggagaggatc
gcccggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccacg
gccaatatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac
agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

KEGG   Felis catus (domestic cat): 493935
Entry
493935            CDS       T02385                                 
Symbol
FOS
Name
(RefSeq) proto-oncogene c-Fos
  KO
K04379  proto-oncogene protein c-fos
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04010  MAPK signaling pathway
fca04024  cAMP signaling pathway
fca04210  Apoptosis
fca04380  Osteoclast differentiation
fca04620  Toll-like receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04668  TNF signaling pathway
fca04713  Circadian entrainment
fca04725  Cholinergic synapse
fca04728  Dopaminergic synapse
fca04915  Estrogen signaling pathway
fca04917  Prolactin signaling pathway
fca04921  Oxytocin signaling pathway
fca04926  Relaxin signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca04932  Non-alcoholic fatty liver disease
fca04935  Growth hormone synthesis, secretion and action
fca05031  Amphetamine addiction
fca05132  Salmonella infection
fca05133  Pertussis
fca05135  Yersinia infection
fca05140  Leishmaniasis
fca05142  Chagas disease
fca05161  Hepatitis B
fca05162  Measles
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05171  Coronavirus disease - COVID-19
fca05200  Pathways in cancer
fca05207  Chemical carcinogenesis - receptor activation
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05210  Colorectal cancer
fca05224  Breast cancer
fca05231  Choline metabolism in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05323  Rheumatoid arthritis
fca05417  Lipid and atherosclerosis
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    493935 (FOS)
   04668 TNF signaling pathway
    493935 (FOS)
   04024 cAMP signaling pathway
    493935 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    493935 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    493935 (FOS)
   04660 T cell receptor signaling pathway
    493935 (FOS)
   04658 Th1 and Th2 cell differentiation
    493935 (FOS)
   04659 Th17 cell differentiation
    493935 (FOS)
   04657 IL-17 signaling pathway
    493935 (FOS)
   04662 B cell receptor signaling pathway
    493935 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    493935 (FOS)
   04917 Prolactin signaling pathway
    493935 (FOS)
   04921 Oxytocin signaling pathway
    493935 (FOS)
   04926 Relaxin signaling pathway
    493935 (FOS)
   04935 Growth hormone synthesis, secretion and action
    493935 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    493935 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    493935 (FOS)
   04728 Dopaminergic synapse
    493935 (FOS)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    493935 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    493935 (FOS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493935 (FOS)
   05207 Chemical carcinogenesis - receptor activation
    493935 (FOS)
   05208 Chemical carcinogenesis - reactive oxygen species
    493935 (FOS)
   05231 Choline metabolism in cancer
    493935 (FOS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    493935 (FOS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    493935 (FOS)
   05224 Breast cancer
    493935 (FOS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    493935 (FOS)
   05170 Human immunodeficiency virus 1 infection
    493935 (FOS)
   05161 Hepatitis B
    493935 (FOS)
   05171 Coronavirus disease - COVID-19
    493935 (FOS)
   05162 Measles
    493935 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    493935 (FOS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    493935 (FOS)
   05135 Yersinia infection
    493935 (FOS)
   05133 Pertussis
    493935 (FOS)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    493935 (FOS)
   05142 Chagas disease
    493935 (FOS)
  09163 Immune disease
   05323 Rheumatoid arthritis
    493935 (FOS)
  09165 Substance dependence
   05031 Amphetamine addiction
    493935 (FOS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    493935 (FOS)
   05418 Fluid shear stress and atherosclerosis
    493935 (FOS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    493935 (FOS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    493935 (FOS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    493935 (FOS)
   04131 Membrane trafficking [BR:fca04131]
    493935 (FOS)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    493935 (FOS)
Membrane trafficking [BR:fca04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    493935 (FOS)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin
Other DBs
NCBI-GeneID: 493935
NCBI-ProteinID: NP_001009341
EnsemblRapid: ENSFCTG00005012814
UniProt: Q8HZP6
LinkDB
Position
B3:120100001..120103418
AA seq 381 aa
MMFSGFNADYEASSSRCSSASPAGDNLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF
IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPAPSAGAYSRAGVVKTVTAGGR
AQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSAL
QTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAF
TLPLLNDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFY
AADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCGAAHR
KGSSSNEPSSDSLSSPTLLAL
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgatgttctctggcttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcc
tccccggccggggacaatctctcctactaccactcaccggccgactccttctccagcatg
ggctctcctgtcaatgcgcaggacttctgcacggatctggccgtctccagcgccaacttt
atcccaacggtgactgccatctccaccagcccggacctgcagtggctggtgcagcccacc
ctggtctcctccgtggctccttcccagaccagagccccccacccctatggagtccccgcc
ccctccgccggggcttactccagggccggagtcgtgaagaccgtgaccgcaggaggccga
gctcagagcattggcaggaggggcaaagtggaacagttgtccccagaagaagaagagaaa
aggagaatccgaagggaaaggaataagatggctgcagccaagtgccggaaccggaggcgg
gagctcacggatacactccaagcggagacagatcaactagaagatgagaagtctgctttg
cagactgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcagct
caccgacccgcctgcaagatccccgatgacctgggcttcccggaagagatgtctgtggct
tccctagatctgagcgggggcctgccggaagctgccacccccgagtcggaggaggctttc
accctgcccctcctcaatgatcctgagcccaagccctccgtagagccggtcaagagcatc
agcagcatggagctgaaggccgagcccttcgatgacttcctgttcccagcatcgtccagg
cccagcggctccgagaccgcccgctctgtgccagacatggacctgtctggttccttctat
gcagcagactgggagcccctgcatggtggctccctggggatggggcccatggccacagag
ctggagcctctgtgcaccccggtggtcacctgtactcctagctgcactacttacacgtct
tccttcgtcttcacctaccctgaggctgactccttccccagctgtggggctgctcaccgc
aagggcagcagcagcaacgaaccctcctctgactcgctcagctcacccacgctgctggcc
ctgtga

DBGET integrated database retrieval system