KEGG   Felis catus (domestic cat): 101098838
Entry
101098838         CDS       T02385                                 
Symbol
MMP2
Name
(RefSeq) 72 kDa type IV collagenase
  KO
K01398  matrix metalloproteinase-2 (gelatinase A) [EC:3.4.24.24]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04670  Leukocyte transendothelial migration
fca04912  GnRH signaling pathway
fca04915  Estrogen signaling pathway
fca04926  Relaxin signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05219  Bladder cancer
fca05415  Diabetic cardiomyopathy
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    101098838 (MMP2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101098838 (MMP2)
   04915 Estrogen signaling pathway
    101098838 (MMP2)
   04926 Relaxin signaling pathway
    101098838 (MMP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101098838 (MMP2)
   05205 Proteoglycans in cancer
    101098838 (MMP2)
  09162 Cancer: specific types
   05219 Bladder cancer
    101098838 (MMP2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101098838 (MMP2)
   05415 Diabetic cardiomyopathy
    101098838 (MMP2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101098838 (MMP2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101098838 (MMP2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fca01002]
    101098838 (MMP2)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.24  gelatinase A
     101098838 (MMP2)
Peptidases and inhibitors [BR:fca01002]
 Metallo peptidases
  Family M10
   101098838 (MMP2)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 Reprolysin_3 Reprolysin_5 Peptidase_M66 Reprolysin_4
Other DBs
NCBI-GeneID: 101098838
NCBI-ProteinID: XP_003998091
Ensembl: ENSFCAG00000005935
LinkDB
Position
E2:35009873..35033753
AA seq 661 aa
MTEARGARGALAGPLRALCVLGCLLGRAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYG
CPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQSTIETMRKPRCGNPDVANYNFFPRKPKW
DKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHG
DGYPFDGKDGLLAHAFAPGPGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLF
NGKEYTSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNADGQPCKFPFRFQG
TSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGSK
HESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGA
LMAPIYTYTKNFRLSHDDIKGIQELYGASPDIDTGTGPTPTLGPVTPEICKQDIVFDGIS
QIRGEIFFFKDRFIWRTVTPRSKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNE
YWVYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNRKTYIFAGDKFWRYNEVKKKMD
PGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLG
C
NT seq 1986 nt   +upstreamnt  +downstreamnt
atgaccgaggcgcgaggggcccggggcgcactcgccggcccgctgcgggcgctctgcgtc
ctgggctgcctgttgggccgcgccgccgccgcgccgtcgcccatcatcaagttccctgga
gatgtggcccccaaaacggacaaagagctggccgtgcaatatctgaacaccttctacggc
tgccccaaggagagctgtaacctgttcgtgctcaaggacacgctaaagaagatgcagaag
ttctttgggctgccccagacgggtgaccttgaccagagcacgattgagaccatgcggaag
cctcgctgtggcaaccctgatgtggccaactacaacttcttcccccgcaagcccaagtgg
gacaagaaccagatcacatacaggatcattggctacacgcctgatctggaccccgagaca
gtggatgatgcctttgctcgtgccttccaagtctggagtgatgtaaccccgctaaggttt
tctcgtatccacgatggagaggcggacatcatgatcaactttggccgctgggagcacgga
gatggatacccctttgatggcaaggacgggctcctggctcacgcctttgccccgggccct
ggcgtcgggggagactcccactttgacgacgatgagctgtggaccctgggagaagggcaa
gtggtccgcgtgaagtacgggaacgccgacggggagtactgcaagttccccttcctgttc
aacggcaaggaatacaccagctgcacggacacgggccgcagcgacggctttctctggtgc
tccaccacctacaactttgaaaaggatggcaaatatggcttctgcccccacgaagccctg
ttcaccatgggtggcaatgctgacggacagccctgcaagttcccattccgcttccaggga
acatcctacgacagctgcaccaccgagggccgcaccgacggctaccgctggtgcgggacc
acggaagactacgacagagacaagaagtatggcttctgccccgagaccgccatgtccact
gttggcgggaactcagaaggtgccccctgtgtcttccccttcaccttcttgggcagcaag
catgagagctgtaccagcgcgggccgcagcgatggcaagatgtggtgtgcgaccacagcc
aactatgacgatgaccgcaagtggggcttctgccccgaccaagggtacagcttgttcctg
gttgcagcccatgagtttggccatgcaatggggctggagcactctcaggaccctggggcc
ctgatggcacccatttatacctacaccaagaacttccgcctgtcccacgacgacatcaag
ggcattcaagagctctacggggcctcccctgacattgacactggcaccggccccacccca
actctcggccccgtcactcctgagatctgcaaacaggacattgtttttgatggcatctct
cagatccggggggagatcttcttcttcaaggacaggttcatttggcgaacagtgacacca
cgtagcaagcccatggggcccctgctggtggccacgttctggcctgagctcccggaaaag
attgatgctgtatacgaggccccacaggaagagaaggctgtgttctttgcagggaatgaa
tactgggtctactcagccagcaccctggagcgagggtaccccaagccgctgaccagcctg
gggctgccccccgacgtccagcgggtagatgctgcgtttaactggagcaagaacaggaag
acctacatctttgctggagacaagttctggaggtacaatgaagtaaagaagaagatggac
cctggcttccccaagctcatcgcggatgcctggaacgccatccccgataacctggacgcc
gtggtcgacctgcagggcggtggtcacagctacttcttcaagggcgcgtattacctgaag
ttggagaaccagagtctgaagagcgtgaaatttggaagcatcaaatccgactggctgggc
tgctga

DBGET integrated database retrieval system