KEGG   Felis catus (domestic cat): 101099143
Entry
101099143         CDS       T02385                                 
Name
(RefSeq) kininogen-1 isoform X1
  KO
K03898  kininogen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04071  Sphingolipid signaling pathway
fca04080  Neuroactive ligand-receptor interaction
fca04610  Complement and coagulation cascades
fca04750  Inflammatory mediator regulation of TRP channels
fca04810  Regulation of actin cytoskeleton
fca05142  Chagas disease
fca05143  African trypanosomiasis
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    101099143
   04022 cGMP-PKG signaling pathway
    101099143
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101099143
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101099143
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101099143
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101099143
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101099143
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101099143
   05143 African trypanosomiasis
    101099143
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fca01002]
    101099143
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101099143
Peptidases and inhibitors [BR:fca01002]
 Peptidase inhibitors
  Family I25: cystatin family
   101099143
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   101099143
  Exosomal proteins of other cancer cells
   101099143
SSDB
Motif
Pfam: Cystatin Cathelicidins Spp-24 SQAPI Bradykinin
Other DBs
NCBI-GeneID: 101099143
NCBI-ProteinID: XP_003991863
Ensembl: ENSFCAG00000013880
LinkDB
Position
C2:complement(83090159..83119710)
AA seq 427 aa
MKLIAVLFLCSRLLPSLTEESVSQEIDCNDEDLFKAVDTALKKYNSRNQSGNQFVLYRVT
EVTRTDDPETFYSFKYQIREGDCSVQSDKTWQDCDYKESAQAATGECSATVGKRANTKFS
VATQTCQITPAEGPVVTSQYDCLGCVHPISTASLDLEPVLRHAIQHFNNHTGHSHLFALR
EVKRAHRQVVAGWNYEMTYSIVQTNCSKEHFLFLTPDCKSLLNGDIGECTDHAHVDLQLR
IASLSQKCELYPGEDFIEPPPSICPGCPKEIPVNSPELEVALNHSTAKLNAENNGTFYFK
IDHVKSATVQVVAGKKFSIEFTAKETTCSKESNEELTESCNTNKFGKILDCKAEVYVIPW
EKKIYPTVHCQSRGETTLMKRPPGFSPFRSVQVEKTKEGTTRHLRPCEYMGRPREAGAEP
AAGSEVS
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgaaattaattgctgtgcttttcctttgctctaggctgctaccaagcttaaccgaggag
tccgtctcacaagaaatcgattgcaatgatgaagacctattcaaggctgtggacactgct
ctgaagaaatataacagtaggaaccaaagtggcaaccagtttgtgttgtaccgtgtaacc
gaggtcaccaggacggatgaccctgagacattttattccttcaagtaccaaatcagggag
ggagactgttctgttcaaagtgacaaaacatggcaggattgtgactacaaagaatctgca
caagctgccacaggggaatgctccgcaaccgtcgggaagagagcgaatacaaaattctcc
gtggctacgcagacctgccagattactccagccgagggtcctgtggtgacaagccagtat
gactgccttggctgtgtgcaccccatatcgactgcgagccttgacctggagcccgttctc
agacacgccattcaacattttaacaaccacaccggtcattcccacctctttgctcttaga
gaagtcaagagggcccacagacaggtggtggctggatggaattatgaaatgacttactca
attgtgcagacgaattgctccaaggaacattttctgttcttaactccagactgcaagtcc
cttttgaatggtgatatcggtgaatgtacagatcacgcacacgtggatctgcagctaaga
attgcttctttgtcgcagaagtgtgaactctatccaggagaggattttatagaaccgcct
cccagtatttgccctggctgtcccaaagagatacctgtcaacagcccagagctggaggtg
gctctgaatcattccactgcaaagcttaatgcggagaataatggaacgttctatttcaag
attgaccacgtgaaaagtgcaacagtacaggtggtggctggaaagaaattttctattgag
ttcacagccaaggaaaccacgtgctccaaggaaagtaatgaagagttgacagaaagttgc
aataccaataaatttggaaaaattctagactgtaaagctgaagtttatgtgataccttgg
gagaagaaaatttaccctactgtccactgtcaatcacggggagagaccacattgatgaaa
aggcctccaggtttttcacctttccgatcagtacaagtggagaaaacaaaagaaggaaca
actaggcatctaaggccctgcgagtacatgggccgacctcgggaggcaggggccgagcca
gcagctgggagtgaggtctcttga

DBGET integrated database retrieval system