KEGG   Felis catus (domestic cat): 101099750
Entry
101099750         CDS       T02385                                 
Symbol
TRAF6
Name
(RefSeq) TNF receptor-associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04064  NF-kappa B signaling pathway
fca04120  Ubiquitin mediated proteolysis
fca04140  Autophagy - animal
fca04144  Endocytosis
fca04380  Osteoclast differentiation
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04722  Neurotrophin signaling pathway
fca04936  Alcoholic liver disease
fca05132  Salmonella infection
fca05133  Pertussis
fca05135  Yersinia infection
fca05140  Leishmaniasis
fca05142  Chagas disease
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05171  Coronavirus disease - COVID-19
fca05200  Pathways in cancer
fca05222  Small cell lung cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101099750 (TRAF6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101099750 (TRAF6)
   04064 NF-kappa B signaling pathway
    101099750 (TRAF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101099750 (TRAF6)
   04140 Autophagy - animal
    101099750 (TRAF6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101099750 (TRAF6)
   04621 NOD-like receptor signaling pathway
    101099750 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    101099750 (TRAF6)
   04657 IL-17 signaling pathway
    101099750 (TRAF6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101099750 (TRAF6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101099750 (TRAF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101099750 (TRAF6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101099750 (TRAF6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101099750 (TRAF6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101099750 (TRAF6)
   05161 Hepatitis B
    101099750 (TRAF6)
   05160 Hepatitis C
    101099750 (TRAF6)
   05171 Coronavirus disease - COVID-19
    101099750 (TRAF6)
   05162 Measles
    101099750 (TRAF6)
   05168 Herpes simplex virus 1 infection
    101099750 (TRAF6)
   05169 Epstein-Barr virus infection
    101099750 (TRAF6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101099750 (TRAF6)
   05135 Yersinia infection
    101099750 (TRAF6)
   05133 Pertussis
    101099750 (TRAF6)
   05152 Tuberculosis
    101099750 (TRAF6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101099750 (TRAF6)
   05140 Leishmaniasis
    101099750 (TRAF6)
   05142 Chagas disease
    101099750 (TRAF6)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101099750 (TRAF6)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    101099750 (TRAF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101099750 (TRAF6)
   04121 Ubiquitin system [BR:fca04121]
    101099750 (TRAF6)
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101099750 (TRAF6)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    101099750 (TRAF6)
Ubiquitin system [BR:fca04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    101099750 (TRAF6)
SSDB
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX zf-RING_2 zf-C3HC4_3 zf-C3HC4_4 zf-TRAF_2 zf-RING_5 Med21 U-box DUF4455 Spc29 Tropomyosin_1 UPF0242 Laminin_I DUF16 SlyX EzrA Sina CENP-F_leu_zip
Other DBs
NCBI-GeneID: 101099750
NCBI-ProteinID: XP_011285100
UniProt: A0A337SQ77
LinkDB
Position
D1:complement(92086397..92104748)
AA seq 541 aa
MSLLNCENSCGSSQSESDCCAAMASSCSAAAKDDSVSGTASTGNLSNSFMEETQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCRACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMNCPQCQRPFQKCQLNIHILK
ECPRRQVSCVNCAALMAFEDKEIHDQNCPLANVICEYCNTMLIREQMPNHYDLDCPTAPI
PCTFSTFGCHVKMQRNHLARHLQENTQSHMRMLAQAVQSLSLALPPVPQCDMPPYDSSSA
SRVSTGCHPEVQNFQETIQQLEGRLVRQDHQIRELIAKMETQSMYVSELKQTIRTLEDKV
VEIEAQQCNGIYIWKIGNFGMHLKSQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPSAQ
RCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPIRQNHEEIMDAKPELLAFQR
PTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDSG
M
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgagtctgctaaactgtgaaaacagctgcggatccagccagtctgagagtgactgctgt
gccgccatggccagctcctgtagcgctgcggcgaaagatgacagtgtgagtggaaccgcc
agcacggggaacctctccaactctttcatggaagagacccaggggtatgacgtggagttt
gacccgcccctggagagcaagtatgagtgccccatctgcctgatggctctccgggaggca
gtgcagacaccgtgcggccacaggttctgcagagcttgcatcatcaaatcaataagggat
gcaggtcacaaatgtccagttgacaatgaaatactgctggaaaatcaactatttcctgac
aattttgcaaaacgagagattctttctctgatggtgaaatgtccaaatgaaggttgtttg
cacaagatggaactgaggcatcttgaggatcaccaagcacattgtgaatttgctcttatg
aattgtcctcagtgccagcgtcccttccaaaaatgccaacttaatattcacattctcaag
gagtgtccaaggagacaggtttcttgtgtaaactgtgctgcattgatggcatttgaagat
aaagagatccacgaccagaactgtcctttggcaaatgtcatctgtgaatactgcaatacc
atgctcatcagagaacagatgcctaatcattacgacctggactgtcctacagccccaatt
ccatgcacattcagtacttttggttgccatgtaaagatgcagaggaatcacttggcacgc
cacctgcaagagaatacccagtcgcacatgagaatgttggcccaggctgttcagagttta
agccttgcgttacctcctgtacctcagtgtgatatgcctccatacgattcttcctctgcg
tcccgggtttccactgggtgtcacccagaggtccagaatttccaagaaaccattcagcag
ttagagggtcgccttgtaagacaagaccatcaaatccgagagctaattgctaaaatggaa
actcagagcatgtacgtaagtgagctcaaacaaacgattcgaacccttgaggacaaagtt
gttgaaatagaagcacagcagtgcaatgggatttacatctggaagattggcaactttggg
atgcatttgaaatctcaagaagaggagaaacctgttgtcattcatagccctggattctac
acaggcaaacccgggtacaaactgtgcatgcgcctgcaccttcagttaccgtcggctcag
cgctgtgctaattacatatccctctttgtgcacacaatgcaaggagagtatgacagccac
ctcccttggcccttccagggtacaatccgccttacgattcttgatcagtctgaggcacct
ataaggcaaaaccatgaagagatcatggatgccaaaccagagctgcttgccttccagaga
cccacaatcccacggaacccaaaaggttttggctatgtgacttttatgcatctggaagcc
ctgagacagagaaccttcattaaggacgatactttattagtgcgctgtgaggtctctacc
cgctttgacatgggtagtctccggagggagggttttcagccacgaagtactgattcaggg
atgtag

DBGET integrated database retrieval system