KEGG   Felis catus (domestic cat): 101100697
Entry
101100697         CDS       T02385                                 
Symbol
IL7R
Name
(RefSeq) interleukin-7 receptor subunit alpha
  KO
K05072  interleukin 7 receptor
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04068  FoxO signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04630  JAK-STAT signaling pathway
fca04640  Hematopoietic cell lineage
fca05200  Pathways in cancer
fca05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101100697 (IL7R)
   04068 FoxO signaling pathway
    101100697 (IL7R)
   04151 PI3K-Akt signaling pathway
    101100697 (IL7R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101100697 (IL7R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101100697 (IL7R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101100697 (IL7R)
  09163 Immune disease
   05340 Primary immunodeficiency
    101100697 (IL7R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101100697 (IL7R)
   04090 CD molecules [BR:fca04090]
    101100697 (IL7R)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL2 receptor family
   101100697 (IL7R)
CD molecules [BR:fca04090]
 Proteins
  101100697 (IL7R)
SSDB
Motif
Pfam: FN3_7 fn3
Other DBs
NCBI-GeneID: 101100697
NCBI-ProteinID: XP_006928117
Ensembl: ENSFCAG00000009200
UniProt: M3WAZ4
LinkDB
Position
A1:complement(213267824..213296226)
AA seq 457 aa
MMILGTAFGMVFYLLQVVSGESGYAQNGDFDDAELDDYPFSCYSQLEVDGSQHLLTCTFD
DPDVNSTNLEFEICGALLDVKCLTFNKMQEMYFIRTKKFLLIGDSEICVKLKGKKITCRK
MNVVKIVKPEAPFDVRVIYREGANDFLVTFNTSHLQKKYVKELLHEVAYRQEKHENDWMH
VNLSSTKLALLQRKLQPDAMYEIKVRSIPNHDYFEGFWSEWSPSFHFRTPEITGRMDPIL
LTISILSFFSVSLMVILACALWKKRIKPIVWPSLPDHKKTLEQLCKKPKKNLNVSFNPES
FLDCQIHKVDGIQARDEAEGFLQDTSLPQPEESEKQRLVGGVQSPTWPSEHAVITPKTFR
GDSPLGCLAGNVSMCEALVLPSSRPPDFRDGGKNGPHVYQGLLLVPGTTNGPGPTPFPFQ
SGILTLNPAAQGQPILTSLGSSQEEAYVTMSSFYQNQ
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgatgattctaggtacagcttttggtatggttttctatttacttcaagtcgtttctgga
gaaagtggctatgcacagaatggggactttgatgatgccgaactggatgactatccattc
tcgtgttacagtcagttggaagtggatggatcccagcacttgctgacctgtacttttgac
gacccagatgtcaatagcaccaatctggaatttgaaatatgtggggctcttttggatgtg
aaatgcctgacttttaataaaatgcaagagatgtatttcatcaggacaaagaaattctta
ctgattggagacagcgaaatatgtgtgaagcttaaaggaaaaaagataacttgcaggaaa
atgaacgtagtcaagatagttaaacctgaggctccttttgacgtaagagtcatctatcgt
gagggagcaaatgactttctggtgacatttaacacatctcacttacaaaagaagtatgtg
aaagaattattgcatgaggtagcctatcgccaggaaaaacatgaaaatgactggatgcat
gtgaacttatccagtacaaagctggcactcctacagagaaagctacaacctgatgcaatg
tatgagattaaagtccggtccattcctaatcatgactattttgaaggcttctggagtgaa
tggagtccaagcttccacttcagaactccagagatcacagggaggatggatcctatttta
ctaactattagcattctgagtttcttctctgtgtctctgatggtcatcttggcctgtgca
ttatggaaaaaaagaattaaacctattgtgtggcccagtctcccggatcataagaagact
ctggaacaactttgcaagaaaccaaaaaagaatttgaatgtgagtttcaatcctgaaagt
ttcctggactgccagattcataaggtggatggcattcaagctagagatgaagccgaaggc
tttctgcaagacacttctctgccacaaccagaggagtctgaaaagcagaggcttgtaggg
ggtgtgcagagccccacctggccatctgagcatgcagtcatcaccccaaaaacgttcaga
ggagattcacccctcggatgcctggctgggaatgtcagtatgtgtgaggcccttgtgctc
ccatcttccagacccccagacttcagggatggtggcaagaatgggcctcatgtgtaccag
ggcctgctgcttgtccctggaactacaaatggccctgggcccactccatttcctttccaa
tcaggaatcctgacattgaacccagctgcccagggacaacccattctcacttccttggga
tcgagccaggaagaagcctatgtcaccatgtccagtttctaccaaaaccagtga

DBGET integrated database retrieval system