KEGG   Felis catus (domestic cat): 102901432
Entry
102901432         CDS       T02385                                 
Name
(RefSeq) growth-regulated protein homolog gamma-like
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04064  NF-kappa B signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04668  TNF signaling pathway
fca04936  Alcoholic liver disease
fca05134  Legionellosis
fca05146  Amoebiasis
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05323  Rheumatoid arthritis
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102901432
   04668 TNF signaling pathway
    102901432
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102901432
   04061 Viral protein interaction with cytokine and cytokine receptor
    102901432
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102901432
   04657 IL-17 signaling pathway
    102901432
   04062 Chemokine signaling pathway
    102901432
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102901432
  09171 Infectious disease: bacterial
   05134 Legionellosis
    102901432
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102901432
  09163 Immune disease
   05323 Rheumatoid arthritis
    102901432
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102901432
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    102901432
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    102901432
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   102901432
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 102901432
NCBI-ProteinID: XP_023108817
LinkDB
Position
B1:complement(147887134..147889310)
AA seq 103 aa
MAHTAPRAPRLLGAALLLLLLVPAARRAAGAPVVTELRCQCLQTVQGIHLKNIQSVKVTQ
SGPHCAHTEVIATLKNGHEACLNPEAPMVKRIIEKMLSKGSNN
NT seq 312 nt   +upstreamnt  +downstreamnt
atggcccacaccgcgccccgcgctccccggctcctcggcgccgcgctgctgctcctgctc
ctggtccccgccgcccggcgcgccgcaggggcgcccgtcgtcaccgagctgcgctgccag
tgcctgcagaccgtgcagggcattcacctcaagaacatccagagcgtcaaggtgacgcag
tcgggcccccactgcgcccacaccgaagtcatagccactctcaagaacggacacgaagcc
tgtctcaaccccgaagcccccatggtcaagagaatcatcgaaaagatgctaagcaagggc
agcaacaactga

KEGG   Felis catus (domestic cat): 111560177
Entry
111560177         CDS       T02385                                 
Name
(RefSeq) growth-regulated protein homolog gamma-like
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04064  NF-kappa B signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04668  TNF signaling pathway
fca04936  Alcoholic liver disease
fca05134  Legionellosis
fca05146  Amoebiasis
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05323  Rheumatoid arthritis
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    111560177
   04668 TNF signaling pathway
    111560177
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111560177
   04061 Viral protein interaction with cytokine and cytokine receptor
    111560177
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111560177
   04657 IL-17 signaling pathway
    111560177
   04062 Chemokine signaling pathway
    111560177
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    111560177
  09171 Infectious disease: bacterial
   05134 Legionellosis
    111560177
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111560177
  09163 Immune disease
   05323 Rheumatoid arthritis
    111560177
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    111560177
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    111560177
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    111560177
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   111560177
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 111560177
NCBI-ProteinID: XP_023108818
LinkDB
Position
B1:complement(147899478..147901525)
AA seq 103 aa
MAHTAPRAPRLLGAALLLLLLVPAARRAAGAPVVTELRCQCLQTVQGIHLKNIQSVKVTQ
SGPHCAHTEVIATLKNGHEACLNPEAPMVKRIIEKMLSKGSTN
NT seq 312 nt   +upstreamnt  +downstreamnt
atggcccacaccgcgccccgcgctccccggctcctcggcgccgcgctgctgctcctgctc
ctggtccccgccgcccggcgcgccgcaggggcgcccgtcgtcaccgagctgcgctgccag
tgcctgcagaccgtgcagggcattcacctcaagaacatccagagcgtcaaggtgacgcag
tcgggcccccactgcgcccacaccgaagtcatagccactctcaagaacggacacgaagcc
tgtctcaaccccgaagcccccatggtcaagagaatcatcgaaaagatgctaagcaagggc
agcaccaactga

DBGET integrated database retrieval system