KEGG   Felis catus (domestic cat): 105261012
Entry
105261012         CDS       T02385                                 
Name
(RefSeq) tumor necrosis factor receptor superfamily member 1A-like
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04115  p53 signaling pathway
fca04210  Apoptosis
fca04217  Necroptosis
fca04650  Natural killer cell mediated cytotoxicity
fca05132  Salmonella infection
fca05164  Influenza A
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    105261012
   04061 Viral protein interaction with cytokine and cytokine receptor
    105261012
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    105261012
   04217 Necroptosis
    105261012
   04115 p53 signaling pathway
    105261012
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    105261012
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    105261012
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105261012
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    105261012
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    105261012
   04090 CD molecules [BR:fca04090]
    105261012
Cytokine receptors [BR:fca04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   105261012
CD molecules [BR:fca04090]
 Proteins
  105261012
SSDB
Motif
Pfam: TNFR_c6 Death
Other DBs
NCBI-GeneID: 105261012
NCBI-ProteinID: XP_011285393
UniProt: A0A5F5XH25
LinkDB
Position
D1:115260348..115278837
AA seq 427 aa
MAAGRSVPWLCALLLLLAAWVDLALGVAPCDVTEYQPEDSNLCCRLCPAGQYVFRPCRVN
HTTGECRVCESGTFLAFPNGEPTCQRCIQCRKGDQEVVAKCSPTSDRQCQCKKGSFYCNS
VDCVENCLRCKRCPGVVLSPCNATSNTVCATETDRGRPENKRGSEFLVPWVTVSVILAVA
VIVGICWYKKKGVRVSYQPIVRLLKGRSDGPGGFPLRSNSQLETVRPEVPERDRPAPGTE
TQPAEEESLALMPKARPHPGPSGEPEESPELQALVVGGSPVVQEQTLEASAPAAPEPQDG
TQASPSLKSLEERYKKEYFVKDNSREATTSIHYEFVKSSAGNDWKMFMRLIGLDETDIDS
CECENPGNLTEQRHKMLLTWRKKLGKDASVFKLLAALHKLGLQMYLQNIINNLVAEGILG
RHVGTSD
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggcggcgggacggagcgtcccgtggctgtgcgccctcctgctgctgctcgcggcctgg
gtggacctggcgctcggcgtggccccgtgtgacgtgaccgagtaccagccggaggacagc
aacctctgctgccggctctgccccgctggccagtacgtcttcagaccgtgcagggtgaac
cataccactggcgagtgccgcgtctgtgaatcgggcaccttcctcgccttccctaatggc
gagcctacttgccagaggtgcatccagtgccggaagggagatcaggaggtggtggccaag
tgctcccccaccagcgaccggcagtgtcagtgcaaaaaggggagcttctactgcaactct
gtggactgcgtggaaaactgcctgcggtgtaaaaggtgtcctggcgttgtcctgtcccct
tgcaatgctaccagcaacacggtttgtgccacagaaactgaccgagggcgtccagaaaac
aaacgtgggtctgagttcctcgtgccgtgggtgaccgttagcgtcattcttgctgtcgcc
gtcattgtcggtatttgttggtataaaaagaaaggtgtgcgggtctcctaccagccgatc
gtcagattgttgaagggaaggtcggatggcccaggcggctttccactgagaagcaattcg
cagcttgagacggtgcgacccgaggtgcctgagcgggacaggccggcccccggcacagaa
acccagcctgcggaggaggagagcctggccttgatgcccaaggccaggccccacccgggg
ccctcaggggagcccgaggaaagccctgagctgcaggccttggtggtcggaggaagcccg
gtggtccaggagcagacgttagaagcctctgctcctgccgctccggagccccaggacggg
acccaggcgtccccttcgctcaagagtctagaggagcgatacaaaaaggaatattttgtc
aaggataactccagagaagctaccactagcatccattatgagtttgtaaagagcagcgcg
ggaaacgactggaagatgttcatgaggttaatcggtctggatgagacggacattgactct
tgcgaatgcgagaatccaggcaatttaacggagcagcgtcataagatgctcttgacgtgg
agaaagaagctgggaaaggacgcttctgtttttaaactcctggctgccctccataaactg
gggcttcaaatgtatctgcaaaacattataaacaacttagttgccgaaggtattttaggc
aggcatgtggggacctccgactaa

DBGET integrated database retrieval system