KEGG   Felis catus (domestic cat): 493676
Entry
493676            CDS       T02385                                 
Symbol
CXCR4
Name
(RefSeq) C-X-C chemokine receptor type 4
  KO
K04189  C-X-C chemokine receptor type 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca03250  Viral life cycle - HIV-1
fca04020  Calcium signaling pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04144  Endocytosis
fca04360  Axon guidance
fca04670  Leukocyte transendothelial migration
fca04672  Intestinal immune network for IgA production
fca04810  Regulation of actin cytoskeleton
fca05163  Human cytomegalovirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    493676 (CXCR4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    493676 (CXCR4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493676 (CXCR4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    493676 (CXCR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    493676 (CXCR4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    493676 (CXCR4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    493676 (CXCR4)
   04672 Intestinal immune network for IgA production
    493676 (CXCR4)
   04062 Chemokine signaling pathway
    493676 (CXCR4)
  09158 Development and regeneration
   04360 Axon guidance
    493676 (CXCR4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493676 (CXCR4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    493676 (CXCR4)
   05163 Human cytomegalovirus infection
    493676 (CXCR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    493676 (CXCR4)
   04050 Cytokine receptors [BR:fca04050]
    493676 (CXCR4)
   04090 CD molecules [BR:fca04090]
    493676 (CXCR4)
G protein-coupled receptors [BR:fca04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    493676 (CXCR4)
Cytokine receptors [BR:fca04050]
 Chemokine receptors
  CXC Chemokine
   493676 (CXCR4)
CD molecules [BR:fca04090]
 Proteins
  493676 (CXCR4)
SSDB
Motif
Pfam: 7tm_1 CXCR4_N 7TM_GPCR_Srsx DUF4538
Other DBs
NCBI-GeneID: 493676
NCBI-ProteinID: NP_001009826
Ensembl: ENSFCAG00000015575
UniProt: P56498
LinkDB
Position
C1:complement(130088795..130092596)
AA seq 353 aa
MDGFRIYPSDNYTEDDLGSGDYDSMKEPCFREENAHFNRIFLPTVYSIIFLTGIVGNGLV
ILVMGYQKKLRSMTDKYRLHLSVADLLFVLTLPFWAVDAVANWYFGKFLCKAVHVIYTVN
LYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVRE
ADGRYICDRFYPSDSWLVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGYQKRKALK
TTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFESTVHKWISITEALAFFHCCLNP
ILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggacgggtttcgtatatacccttcagataactacaccgaagatgacttgggctcaggc
gactatgactccatgaaggaaccctgcttccgggaggaaaatgcccatttcaaccgtatc
tttctgcccactgtctactccatcatcttcttgactggcatagtgggcaatggattggtc
atcctggtcatgggttaccagaagaaactgagaagcatgacagacaagtacagattgcac
ctatctgtggcagacctcctctttgtcctcacacttcccttctgggcagttgatgctgtg
gcaaactggtattttggaaagtttctgtgcaaggcagtccatgtcatctacacagtcaac
ctctacagcagtgtcctcatcctggccttcatcagtctggaccggtacttggctattgtc
catgccaccaacagtcagaggccaaggaagctgttggctgaaaaggtggtctatgttggt
gtctggatacctgccctcctgttgactattcctgatttcatctttgctaatgtcagagag
gcagatgggaggtatatctgtgaccgcttctatcccagtgactcgtggttggtggtattc
cagtttcagcacatcatggttggccttatcctgccaggtattgtcatcctgtcctgctat
tgcattatcatctccaagctctcccactccaagggctaccagaagcgcaaggccctcaag
accacagttatcctcattctggctttctttgcctgctggctcccctactacatagggatc
agcatcgattccttcatcctcctggaaatcatcaagcaaggatgtgagtttgagagcact
gtgcacaagtggatttccatcaccgaggccctagcctttttccactgttgcctgaacccc
atcctctatgccttccttggagccaaatttaaaacctctgcccagcatgcactcacctct
gtgagcagagggtccagcctcaagatcctttccaaagggaagcggggaggacattcttct
gtttcaactgagtccgagtcttccagttttcactccagctaa

DBGET integrated database retrieval system