KEGG   Felis catus (domestic cat): 493683
Entry
493683            CDS       T02385                                 

Symbol
IL10
Name
(RefSeq) interleukin-10 precursor
  KO
K05443  interleukin 10
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04068  FoxO signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04630  JAK-STAT signaling pathway
fca04660  T cell receptor signaling pathway
fca04672  Intestinal immune network for IgA production
fca05133  Pertussis
fca05135  Yersinia infection
fca05140  Leishmaniasis
fca05142  Chagas disease
fca05143  African trypanosomiasis
fca05144  Malaria
fca05145  Toxoplasmosis
fca05146  Amoebiasis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    493683 (IL10)
   04068 FoxO signaling pathway
    493683 (IL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493683 (IL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    493683 (IL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    493683 (IL10)
   04660 T cell receptor signaling pathway
    493683 (IL10)
   04672 Intestinal immune network for IgA production
    493683 (IL10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    493683 (IL10)
   05133 Pertussis
    493683 (IL10)
   05150 Staphylococcus aureus infection
    493683 (IL10)
   05152 Tuberculosis
    493683 (IL10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    493683 (IL10)
   05144 Malaria
    493683 (IL10)
   05145 Toxoplasmosis
    493683 (IL10)
   05140 Leishmaniasis
    493683 (IL10)
   05142 Chagas disease
    493683 (IL10)
   05143 African trypanosomiasis
    493683 (IL10)
  09163 Immune disease
   05310 Asthma
    493683 (IL10)
   05322 Systemic lupus erythematosus
    493683 (IL10)
   05320 Autoimmune thyroid disease
    493683 (IL10)
   05321 Inflammatory bowel disease
    493683 (IL10)
   05330 Allograft rejection
    493683 (IL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    493683 (IL10)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    493683 (IL10)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interleukins
   493683 (IL10)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Cytokines
   493683 (IL10)
SSDB
Motif
Pfam: IL10 IL22 CLZ DUF6364
Other DBs
NCBI-GeneID: 493683
NCBI-ProteinID: NP_001009209
Ensembl: ENSFCAG00000013515
UniProt: P55029
LinkDB
Position
F1
AA seq 178 aa
MHSSALLCFLVFLAGVGASRHQSTLSEDNCTHFSVSLPHMLXELRAAFGKVKTFFQTKDE
LHSILLTRSLLEDFKGYLGCQALSEMIQFYLEEVMPQAENEDPDIKQHVNSLGEKLKTLR
LRLRRCHRFLPCENKSKVVEQVKSTFSKLQEKGVYKAMGEFDIFINYIEAYMTMKMKI
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcacagctcagcacttctgtgtttcctggtcttcctggccggggtaggagccagccga
caccagagcaccctgtctgaggacaactgcacccacttctcagtcagcctgccccacatg
ctccragagctccgagctgccttcggcaaggtgaagactttctttcaaaccaaggacgag
ctgcacagcatattgttgaccaggtccttgctggaggactttaagggttacctgggttgc
caagccttgtccgagatgatccagttttatttggaggaggtgatgccccaggctgagaac
gaggacccagacatcaaacagcacgtgaactccctgggagaaaagctgaagaccctccgg
ctgagactgcggcgctgtcatcgatttctgccctgtgaaaacaagagcaaggtggtggag
caggtgaagagtacctttagtaagctccaagagaaaggtgtctacaaagccatgggtgag
tttgacatcttcatcaactacatagaagcttacatgacaatgaagatgaaaatctga

DBGET integrated database retrieval system