Felis catus (domestic cat): 493683 Help Entry 493683            CDS       T02385                                  Symbol IL10 Name (RefSeq) interleukin-10 precursor   KO K05443   interleukin 10 Organism fca  Felis catus (domestic cat) Pathway fca04060   Cytokine-cytokine receptor interaction fca04061   Viral protein interaction with cytokine and cytokine receptor fca04068   FoxO signaling pathway fca04148   Efferocytosis fca04625   C-type lectin receptor signaling pathway fca04630   JAK-STAT signaling pathway fca04660   T cell receptor signaling pathway fca04672   Intestinal immune network for IgA production fca05133   Pertussis fca05135   Yersinia infection fca05140   Leishmaniasis fca05142   Chagas disease fca05143   African trypanosomiasis fca05144   Malaria fca05145   Toxoplasmosis fca05146   Amoebiasis fca05150   Staphylococcus aureus infection fca05152   Tuberculosis fca05310   Asthma fca05320   Autoimmune thyroid disease fca05321   Inflammatory bowel disease fca05322   Systemic lupus erythematosus fca05330   Allograft rejection Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     493683 (IL10)    04068 FoxO signaling pathway     493683 (IL10)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     493683 (IL10)    04061 Viral protein interaction with cytokine and cytokine receptor     493683 (IL10)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     493683 (IL10)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     493683 (IL10)    04660 T cell receptor signaling pathway     493683 (IL10)    04672 Intestinal immune network for IgA production     493683 (IL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     493683 (IL10)    05133 Pertussis     493683 (IL10)    05150 Staphylococcus aureus infection     493683 (IL10)    05152 Tuberculosis     493683 (IL10)   09174 Infectious disease: parasitic    05146 Amoebiasis     493683 (IL10)    05144 Malaria     493683 (IL10)    05145 Toxoplasmosis     493683 (IL10)    05140 Leishmaniasis     493683 (IL10)    05142 Chagas disease     493683 (IL10)    05143 African trypanosomiasis     493683 (IL10)   09163 Immune disease    05310 Asthma     493683 (IL10)    05322 Systemic lupus erythematosus     493683 (IL10)    05320 Autoimmune thyroid disease     493683 (IL10)    05321 Inflammatory bowel disease     493683 (IL10)    05330 Allograft rejection     493683 (IL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:fca04052]     493683 (IL10)    00536 Glycosaminoglycan binding proteins [BR:fca00536]     493683 (IL10) Cytokines and neuropeptides [BR:fca04052]  Cytokines   Interleukins    493683 (IL10) Glycosaminoglycan binding proteins [BR:fca00536]  Heparan sulfate / Heparin   Cytokines    493683 (IL10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL10 IL22 CLZ Motif Other DBs NCBI-GeneID:  493683 NCBI-ProteinID:  NP_001009209 UniProt:  P55029 LinkDB All DBs Position F1:35669819..35673712 Genome browser AA seq 178 aa AA seqDB search MHSSALLCFLVFLAGVGASRHQSTLSEDNCTHFSVSLPHMLXELRAAFGKVKTFFQTKDE LHSILLTRSLLEDFKGYLGCQALSEMIQFYLEEVMPQAENEDPDIKQHVNSLGEKLKTLR LRLRRCHRFLPCENKSKVVEQVKSTFSKLQEKGVYKAMGEFDIFINYIEAYMTMKMKI NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgcacagctcagcacttctgtgtttcctggtcttcctggccggggtaggagccagccga caccagagcaccctgtctgaggacaactgcacccacttctcagtcagcctgccccacatg ctccragagctccgagctgccttcggcaaggtgaagactttctttcaaaccaaggacgag ctgcacagcatattgttgaccaggtccttgctggaggactttaagggttacctgggttgc caagccttgtccgagatgatccagttttatttggaggaggtgatgccccaggctgagaac gaggacccagacatcaaacagcacgtgaactccctgggagaaaagctgaagaccctccgg ctgagactgcggcgctgtcatcgatttctgccctgtgaaaacaagagcaaggtggtggag caggtgaagagtacctttagtaagctccaagagaaaggtgtctacaaagccatgggtgag tttgacatcttcatcaactacatagaagcttacatgacaatgaagatgaaaatctga

DBGET integrated database retrieval system