KEGG   Felis catus (domestic cat): 493687
Entry
493687            CDS       T02385                                 
Symbol
IL6
Name
(RefSeq) interleukin-6 precursor
  KO
K05405  interleukin 6
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01523  Antifolate resistance
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04066  HIF-1 signaling pathway
fca04068  FoxO signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04218  Cellular senescence
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04625  C-type lectin receptor signaling pathway
fca04630  JAK-STAT signaling pathway
fca04640  Hematopoietic cell lineage
fca04657  IL-17 signaling pathway
fca04659  Th17 cell differentiation
fca04668  TNF signaling pathway
fca04672  Intestinal immune network for IgA production
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04936  Alcoholic liver disease
fca05010  Alzheimer disease
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05132  Salmonella infection
fca05133  Pertussis
fca05134  Legionellosis
fca05135  Yersinia infection
fca05142  Chagas disease
fca05143  African trypanosomiasis
fca05144  Malaria
fca05146  Amoebiasis
fca05152  Tuberculosis
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05171  Coronavirus disease - COVID-19
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05321  Inflammatory bowel disease
fca05323  Rheumatoid arthritis
fca05332  Graft-versus-host disease
fca05410  Hypertrophic cardiomyopathy
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    493687 (IL6)
   04668 TNF signaling pathway
    493687 (IL6)
   04066 HIF-1 signaling pathway
    493687 (IL6)
   04068 FoxO signaling pathway
    493687 (IL6)
   04151 PI3K-Akt signaling pathway
    493687 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493687 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    493687 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    493687 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    493687 (IL6)
   04620 Toll-like receptor signaling pathway
    493687 (IL6)
   04621 NOD-like receptor signaling pathway
    493687 (IL6)
   04623 Cytosolic DNA-sensing pathway
    493687 (IL6)
   04625 C-type lectin receptor signaling pathway
    493687 (IL6)
   04659 Th17 cell differentiation
    493687 (IL6)
   04657 IL-17 signaling pathway
    493687 (IL6)
   04672 Intestinal immune network for IgA production
    493687 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493687 (IL6)
   05202 Transcriptional misregulation in cancer
    493687 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    493687 (IL6)
   05161 Hepatitis B
    493687 (IL6)
   05171 Coronavirus disease - COVID-19
    493687 (IL6)
   05164 Influenza A
    493687 (IL6)
   05162 Measles
    493687 (IL6)
   05168 Herpes simplex virus 1 infection
    493687 (IL6)
   05163 Human cytomegalovirus infection
    493687 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    493687 (IL6)
   05169 Epstein-Barr virus infection
    493687 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    493687 (IL6)
   05135 Yersinia infection
    493687 (IL6)
   05133 Pertussis
    493687 (IL6)
   05134 Legionellosis
    493687 (IL6)
   05152 Tuberculosis
    493687 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    493687 (IL6)
   05144 Malaria
    493687 (IL6)
   05142 Chagas disease
    493687 (IL6)
   05143 African trypanosomiasis
    493687 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    493687 (IL6)
   05321 Inflammatory bowel disease
    493687 (IL6)
   05332 Graft-versus-host disease
    493687 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    493687 (IL6)
   05020 Prion disease
    493687 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    493687 (IL6)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    493687 (IL6)
   05410 Hypertrophic cardiomyopathy
    493687 (IL6)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    493687 (IL6)
   04932 Non-alcoholic fatty liver disease
    493687 (IL6)
   04931 Insulin resistance
    493687 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    493687 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    493687 (IL6)
   01523 Antifolate resistance
    493687 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    493687 (IL6)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interleukins
   493687 (IL6)
SSDB
Motif
Pfam: IL6 GCSF DUF4924 IL23
Other DBs
NCBI-GeneID: 493687
NCBI-ProteinID: NP_001009211
Ensembl: ENSFCAG00000009165
UniProt: P41683
LinkDB
Position
A2:116632046..116637410
AA seq 207 aa
MNFLSTSAFSPLAFSLGLLLVVATAFPTPGPLGGDATSNRLPLTPADKMEELIKYILGKI
SALKKEMCDNYNKCEDSKEALAENNLNLPKLAEKDGCFQSGFNQETCLTRITTGLQEFQI
YLKFLQDKYEGDKENAKSVYTSTNVLLQMLKRKGKNQDEVTIPVPTVEVGLQLSCSHRRV
AEAHNNHLTLRRLEDFLQLRLRAVRIM
NT seq 624 nt   +upstreamnt  +downstreamnt
atgaacttcctctccacaagcgccttcagtccactcgccttctccctggggctgctcctg
gtggtggctactgctttccctaccccgggacccctgggaggagatgccacctcaaataga
ctaccactcacccctgcagacaaaatggaagaactcattaagtacatcctcggcaaaatc
tctgcactgaaaaaggagatgtgtgacaactataacaaatgtgaggacagcaaggaggca
ctggcagaaaacaacctgaatcttccgaaactggcagaaaaagatggatgcttccaatct
gggttcaatcaggagacctgcctgacaagaatcactactggtcttcaggagtttcagata
tacctgaaattcctccaggacaagtatgagggtgataaggaaaatgccaagtctgtgtac
accagtactaacgtcctgctccagatgctgaagcgtaagggaaagaatcaggatgaggta
accatccctgtcccaaccgtagaagttggcctgcagctaagctgcagtcacagaagagtg
gctgaggcacacaacaatcacctcacccttcgaaggctagaggacttccttcagttacgc
ctcagggctgttcggataatgtaa

DBGET integrated database retrieval system