KEGG   Felis catus (domestic cat): 493688
Entry
493688            CDS       T02385                                 
Symbol
IL18
Name
(RefSeq) interleukin-18 precursor
  KO
K05482  interleukin 18
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04621  NOD-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca05132  Salmonella infection
fca05134  Legionellosis
fca05135  Yersinia infection
fca05143  African trypanosomiasis
fca05144  Malaria
fca05152  Tuberculosis
fca05164  Influenza A
fca05321  Inflammatory bowel disease
fca05323  Rheumatoid arthritis
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493688 (IL18)
   04061 Viral protein interaction with cytokine and cytokine receptor
    493688 (IL18)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    493688 (IL18)
   04623 Cytosolic DNA-sensing pathway
    493688 (IL18)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    493688 (IL18)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    493688 (IL18)
   05135 Yersinia infection
    493688 (IL18)
   05134 Legionellosis
    493688 (IL18)
   05152 Tuberculosis
    493688 (IL18)
  09174 Infectious disease: parasitic
   05144 Malaria
    493688 (IL18)
   05143 African trypanosomiasis
    493688 (IL18)
  09163 Immune disease
   05323 Rheumatoid arthritis
    493688 (IL18)
   05321 Inflammatory bowel disease
    493688 (IL18)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    493688 (IL18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    493688 (IL18)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interleukins
   493688 (IL18)
SSDB
Motif
Pfam: IL1
Other DBs
NCBI-GeneID: 493688
NCBI-ProteinID: NP_001009213
Ensembl: ENSFCAG00000029199
UniProt: Q95M33 A2IRI7
LinkDB
Position
D1:complement(10128958..10147653)
AA seq 192 aa
MAAIPVDDCINFVGMKFIDNTLYFVADSDENLETDYFGKLEHKLSILRNLNDQVLFINQG
DQPVFEDMPDSDCTDNAPRTEFIIYMYKDSLTRGLAVTISVNYKTMSTLSCENKIISFKE
MSPPESINDEGNDIIFFQRSVPGHDDKIQFESSLYKGYFLACEKEKDLFKLILKKKDENG
DKSIMFTVQNKN
NT seq 579 nt   +upstreamnt  +downstreamnt
atggctgctataccagtagatgattgcatcaactttgtgggaatgaaatttattgacaat
acactttactttgtagctgacagtgatgaaaacctggaaacagattactttggcaagctt
gaacataaactctcaatcttacgaaacttgaacgaccaagttctcttcattaaccaggga
gatcaacctgtgtttgaggatatgcctgattctgactgtacagataatgcaccccggact
gaatttatcatatatatgtataaagatagcctcactagaggtctggcagtaaccatctct
gtgaattataagaccatgtctactctctcctgtgagaacaaaattatttcctttaaggaa
atgagtcctcctgagagtatcaatgatgaaggaaatgacatcatattctttcagagaagt
gttccaggacatgatgataagatacaatttgagtcttcattgtacaaggggtactttcta
gcttgtgaaaaagagaaagatcttttcaaactcattttgaaaaaaaaggatgaaaatggg
gataagtccataatgttcactgttcaaaacaagaattag

DBGET integrated database retrieval system