KEGG   Felis catus (domestic cat): 493775
Entry
493775            CDS       T02385                                 
Symbol
CD4
Name
(RefSeq) T-cell surface glycoprotein CD4 precursor
  KO
K06454  T-cell surface glycoprotein CD4
Organism
fca  Felis catus (domestic cat)
Pathway
fca03250  Viral life cycle - HIV-1
fca04060  Cytokine-cytokine receptor interaction
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca05135  Yersinia infection
fca05166  Human T-cell leukemia virus 1 infection
fca05170  Human immunodeficiency virus 1 infection
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    493775 (CD4)
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493775 (CD4)
   04514 Cell adhesion molecules
    493775 (CD4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    493775 (CD4)
   04612 Antigen processing and presentation
    493775 (CD4)
   04660 T cell receptor signaling pathway
    493775 (CD4)
   04658 Th1 and Th2 cell differentiation
    493775 (CD4)
   04659 Th17 cell differentiation
    493775 (CD4)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    493775 (CD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    493775 (CD4)
   05170 Human immunodeficiency virus 1 infection
    493775 (CD4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    493775 (CD4)
  09163 Immune disease
   05340 Primary immunodeficiency
    493775 (CD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    493775 (CD4)
CD molecules [BR:fca04090]
 Proteins
  493775 (CD4)
SSDB
Motif
Pfam: CD4-extracel C2-set ig Ig_3 V-set Ig_2 I-set Ig_5 Receptor_2B4 Tcell_CD4_C M60-like_N V-set_CD47
Other DBs
NCBI-GeneID: 493775
NCBI-ProteinID: NP_001009250
Ensembl: ENSFCAG00000004269
UniProt: P79355
LinkDB
Position
B4:41839409..41885635
AA seq 474 aa
MNQGAVFRHLLLVLQLVMLKAAVPQGKEVVLGKAGGTAELPCQASQKKYMTFTWRLSSQV
KILESQHSSLCLTGSSKLKTRFESKKILWDQGSFPLVIKSLQVADSGIYTCEVENKKREV
ELLVFGLTAKVDPSGSGGSSSSSTSTSTSIYLLQGQSLTLTLESPSSSNPSVQWKGPGNK
SKSGVHSLSLSQLELQESGTCTCTVSQSQKTLVFNTNILVLAFRKVSNTVYAKEGEQVEF
SFPLNFEDENLMGNLRWKAEGAPSSLLWISFTLKNKQLSVKEVDPYSKLQMMDSLPLRFT
LPNVLSRYAGSGNLTLVLDKGQLQQEVKLVVMRVTQSGNNLTCEVLGPTSPELTLSLKLK
GQAAKVSKQQKMVRVEDAEAGTWQCLLSHKDKVLLASKAEVLPPVLTRTWTNLLTIVLGG
VLGLVLYIGLWVYCCVKCWHRRRQAARMSHIKRLLSEKKTCQCSHRLQKTCNPI
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgaatcaaggagccgtttttaggcacctgctcctggtgctgcagctggtgatgctcaaa
gcagctgtgcctcagggaaaggaagtggtgctggggaaggcaggaggcacggcagagctg
ccctgccaagcatcccagaagaagtacatgacctttacctggagactttcttcccaggtc
aagattctggaaagtcagcactcctccttatgccttacaggctcctccaagctgaaaact
cgctttgaatccaaaaaaatcctgtgggaccaaggatcctttcctctggtcatcaagagc
cttcaagtcgcagactcagggatttacacctgtgaagtggagaacaagaaaagagaggtg
gaactgttggtgttcggcttgactgccaaggtggaccccagcggcagcggcggcagcagc
agcagcagcaccagcaccagcaccagcatctatctgctgcaagggcagagcctgaccctg
accttggagagcccctccagtagtaacccttcggtgcaatggaaaggtccagggaataaa
agcaagagtggggtccacagcctctcactgtcccagctggagttgcaggagagtggcacc
tgcacatgcactgtctcccagagccagaagacactggtgttcaacacaaacatcttggtg
ctggctttccggaaggtctctaacacggtctatgcgaaagaaggggagcaggtggagttt
tccttcccgctcaacttcgaagatgaaaacctgatggggaacctgaggtggaaggcagag
ggggctccctcctccctgctctggatctccttcaccttgaagaacaagcagctatctgtg
aaagaggttgacccgtactccaaactccagatgatggactcactcccgctccgctttacg
ctgcccaacgttttgtctcgttatgctggttctggaaacctgaccttggtccttgacaag
ggacagttgcagcaggaagtaaaactcgtggtgatgagagtgactcagtctgggaacaat
ctgacctgtgaggtgctgggacccacctcccctgagctgacgctgagcttgaaactcaaa
ggacaggctgccaaggtctcaaagcagcagaagatggtaagggtggaggacgccgaggcg
ggaacatggcaatgtctactgagtcacaaggacaaagtcttgctggcatccaaggccgag
gttttgcctcctgtgctcaccaggacctggacaaatctcttgaccatcgtgctgggcggg
gtcctaggccttgtgctttacattgggctctgggtctactgctgtgttaagtgctggcac
cgcaggcgccaggcagcgcggatgtctcatatcaagagactcctcagtgagaagaaaacc
tgtcagtgctcccaccggttacagaagacatgtaatcccatttga

DBGET integrated database retrieval system