KEGG   Felis catus (domestic cat): 493806
Entry
493806            CDS       T02385                                 
Symbol
CXCL12
Name
(RefSeq) stromal cell-derived factor 1 precursor
  KO
K10031  C-X-C motif chemokine 12
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04064  NF-kappa B signaling pathway
fca04360  Axon guidance
fca04670  Leukocyte transendothelial migration
fca04672  Intestinal immune network for IgA production
fca04810  Regulation of actin cytoskeleton
fca05163  Human cytomegalovirus infection
fca05200  Pathways in cancer
fca05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    493806 (CXCL12)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493806 (CXCL12)
   04061 Viral protein interaction with cytokine and cytokine receptor
    493806 (CXCL12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    493806 (CXCL12)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    493806 (CXCL12)
   04672 Intestinal immune network for IgA production
    493806 (CXCL12)
   04062 Chemokine signaling pathway
    493806 (CXCL12)
  09158 Development and regeneration
   04360 Axon guidance
    493806 (CXCL12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493806 (CXCL12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    493806 (CXCL12)
  09163 Immune disease
   05323 Rheumatoid arthritis
    493806 (CXCL12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    493806 (CXCL12)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    493806 (CXCL12)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   493806 (CXCL12)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Chemokines
   493806 (CXCL12)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 493806
NCBI-ProteinID: NP_001009847
Ensembl: ENSFCAG00000007670
UniProt: O62657
LinkDB
Position
D2:50847763..50859579
AA seq 93 aa
MDAKVVAVLALVLAALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV
ARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
NT seq 282 nt   +upstreamnt  +downstreamnt
atggatgccaaggtcgtcgccgtgctggccctcgtgctggctgcgctctgcctcagcgac
gggaaaccggtcagcctgagctacagatgtccttgccgattcttcgagagccacgttgcc
agagccaacgtcaagcatctcaaaatcctcaacactcccaactgtgcccttcagatcgtg
gcgaggctgaagaacaacaatagacaagtgtgcattgacccgaaattgaagtggattcag
gaatacctggagaaagctttaaacaagaggttcaagatgtga

DBGET integrated database retrieval system