Felis catus (domestic cat): 493849 Help Entry 493849            CDS       T02385                                  Symbol IFNB1 Name (RefSeq) interferon beta precursor   KO K05415   interferon beta Organism fca  Felis catus (domestic cat) Pathway fca04060   Cytokine-cytokine receptor interaction fca04151   PI3K-Akt signaling pathway fca04217   Necroptosis fca04380   Osteoclast differentiation fca04620   Toll-like receptor signaling pathway fca04621   NOD-like receptor signaling pathway fca04622   RIG-I-like receptor signaling pathway fca04623   Cytosolic DNA-sensing pathway fca04630   JAK-STAT signaling pathway fca04650   Natural killer cell mediated cytotoxicity fca04668   TNF signaling pathway fca04936   Alcoholic liver disease fca05135   Yersinia infection fca05142   Chagas disease fca05152   Tuberculosis fca05160   Hepatitis C fca05161   Hepatitis B fca05162   Measles fca05163   Human cytomegalovirus infection fca05164   Influenza A fca05165   Human papillomavirus infection fca05167   Kaposi sarcoma-associated herpesvirus infection fca05168   Herpes simplex virus 1 infection fca05169   Epstein-Barr virus infection fca05170   Human immunodeficiency virus 1 infection fca05171   Coronavirus disease - COVID-19 fca05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     493849 (IFNB1)    04668 TNF signaling pathway     493849 (IFNB1)    04151 PI3K-Akt signaling pathway     493849 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     493849 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     493849 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     493849 (IFNB1)    04621 NOD-like receptor signaling pathway     493849 (IFNB1)    04622 RIG-I-like receptor signaling pathway     493849 (IFNB1)    04623 Cytosolic DNA-sensing pathway     493849 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     493849 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     493849 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     493849 (IFNB1)    05161 Hepatitis B     493849 (IFNB1)    05160 Hepatitis C     493849 (IFNB1)    05171 Coronavirus disease - COVID-19     493849 (IFNB1)    05164 Influenza A     493849 (IFNB1)    05162 Measles     493849 (IFNB1)    05168 Herpes simplex virus 1 infection     493849 (IFNB1)    05163 Human cytomegalovirus infection     493849 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     493849 (IFNB1)    05169 Epstein-Barr virus infection     493849 (IFNB1)    05165 Human papillomavirus infection     493849 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     493849 (IFNB1)    05152 Tuberculosis     493849 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     493849 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     493849 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     493849 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:fca04052]     493849 (IFNB1) Cytokines and neuropeptides [BR:fca04052]  Cytokines   Interferons    493849 (IFNB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  493849 NCBI-ProteinID:  NP_001009297 Ensembl:  ENSFCAG00000004604 UniProt:  Q9N2J0 A1YQW1 LinkDB All DBs Position D4:complement(45647408..45647968) Genome browser AA seq 186 aa AA seqDB search MTGRCILQIALLVCFFTTAHSVSYKLLGFQLRSSSLECQELLVNLNRTSKYCLKDRMNFE VPEEIKKSQRFQKEEAILVINEMFQKIFNIFSRSTSSTGWNETTVENLLATLHWQKEHLE TILEEIMEEENFTWDNTTLLNLKKYYLRIVRYLKAKEYSVCAWTVVHAEILRNFFFLERL TDYLQN NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgaccggcaggtgcatcctccaaatcgctctcttggtgtgtttcttcaccaccgcgcat tccgtgagctacaagttgcttggattccaactaagaagcagcagtttggagtgtcaggag ctcctggtgaacttgaacagaacctctaaatattgcctcaaggacaggatgaacttcgag gtccctgaggagattaaaaaatcacagcggttccagaaggaggaagccatattggtcatc aacgagatgttccagaagatctttaatattttcagtagaagcacctctagcacgggatgg aatgagaccactgttgagaacctccttgcgacactccactggcagaaggaacacctggaa acgatcctggaggaaatcatggaggaggaaaacttcacctgggacaatacgacccttctg aacctgaagaaatactacttaaggattgtgcggtacctgaaggccaaggagtacagcgtc tgtgcctggacagtagtccacgcagaaatcctcagaaactttttcttccttgagagactt acagattacctccaaaactga

DBGET integrated database retrieval system