KEGG   Felis catus (domestic cat): 493849
Entry
493849            CDS       T02385                                 
Symbol
IFNB1
Name
(RefSeq) interferon beta precursor
  KO
K05415  interferon beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04217  Necroptosis
fca04380  Osteoclast differentiation
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04630  JAK-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04668  TNF signaling pathway
fca04936  Alcoholic liver disease
fca05135  Yersinia infection
fca05142  Chagas disease
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05171  Coronavirus disease - COVID-19
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    493849 (IFNB1)
   04668 TNF signaling pathway
    493849 (IFNB1)
   04151 PI3K-Akt signaling pathway
    493849 (IFNB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493849 (IFNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    493849 (IFNB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    493849 (IFNB1)
   04621 NOD-like receptor signaling pathway
    493849 (IFNB1)
   04622 RIG-I-like receptor signaling pathway
    493849 (IFNB1)
   04623 Cytosolic DNA-sensing pathway
    493849 (IFNB1)
   04650 Natural killer cell mediated cytotoxicity
    493849 (IFNB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    493849 (IFNB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    493849 (IFNB1)
   05161 Hepatitis B
    493849 (IFNB1)
   05160 Hepatitis C
    493849 (IFNB1)
   05171 Coronavirus disease - COVID-19
    493849 (IFNB1)
   05164 Influenza A
    493849 (IFNB1)
   05162 Measles
    493849 (IFNB1)
   05168 Herpes simplex virus 1 infection
    493849 (IFNB1)
   05163 Human cytomegalovirus infection
    493849 (IFNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    493849 (IFNB1)
   05169 Epstein-Barr virus infection
    493849 (IFNB1)
   05165 Human papillomavirus infection
    493849 (IFNB1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    493849 (IFNB1)
   05152 Tuberculosis
    493849 (IFNB1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    493849 (IFNB1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    493849 (IFNB1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    493849 (IFNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    493849 (IFNB1)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interferons
   493849 (IFNB1)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 493849
NCBI-ProteinID: NP_001009297
Ensembl: ENSFCAG00000004604
UniProt: Q9N2J0 A1YQW1
LinkDB
Position
D4:complement(47624644..47625204)
AA seq 186 aa
MTGRCILQIALLVCFFTTAHSVSYKLLGFQLRSSSLECQELLVNLNRTSKYCLKDRMNFE
VPEEIKKSQRFQKEEAILVINEMFQKIFNIFSRSTSSTGWNETTVENLLATLHWQKEHLE
TILEEIMEEENFTWDNTTLLNLKKYYLRIVRYLKAKEYSVCAWTVVHAEILRNFFFLERL
TDYLQN
NT seq 561 nt   +upstreamnt  +downstreamnt
atgaccggcaggtgcatcctccaaatcgctctcttggtgtgtttcttcaccaccgcgcat
tccgtgagctacaagttgcttggattccaactaagaagcagcagtttggagtgtcaggag
ctcctggtgaacttgaacagaacctctaaatattgcctcaaggacaggatgaacttcgag
gtccctgaggagattaaaaaatcacagcggttccagaaggaggaagccatattggtcatc
aacgagatgttccagaagatctttaatattttcagtagaagcacctctagcacgggatgg
aatgagaccactgttgagaacctccttgcgacactccactggcagaaggaacacctggaa
acgatcctggaggaaatcatggaggaggaaaacttcacctgggacaatacgacccttctg
aacctgaagaaatactacttaaggattgtgcggtacctgaaggccaaggagtacagcgtc
tgtgcctggacagtagtccacgcagaaatcctcagaaactttttcttccttgagagactt
acagattacctccaaaactga

DBGET integrated database retrieval system