Felis catus (domestic cat): 493934 Help Entry 493934            CDS       T02385                                  Symbol BCL2 Name (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism fca  Felis catus (domestic cat) Pathway fca01521   EGFR tyrosine kinase inhibitor resistance fca01522   Endocrine resistance fca01524   Platinum drug resistance fca04064   NF-kappa B signaling pathway fca04066   HIF-1 signaling pathway fca04071   Sphingolipid signaling pathway fca04115   p53 signaling pathway fca04140   Autophagy - animal fca04141   Protein processing in endoplasmic reticulum fca04151   PI3K-Akt signaling pathway fca04210   Apoptosis fca04215   Apoptosis - multiple species fca04217   Necroptosis fca04261   Adrenergic signaling in cardiomyocytes fca04340   Hedgehog signaling pathway fca04510   Focal adhesion fca04621   NOD-like receptor signaling pathway fca04630   JAK-STAT signaling pathway fca04722   Neurotrophin signaling pathway fca04725   Cholinergic synapse fca04915   Estrogen signaling pathway fca04928   Parathyroid hormone synthesis, secretion and action fca04933   AGE-RAGE signaling pathway in diabetic complications fca05014   Amyotrophic lateral sclerosis fca05022   Pathways of neurodegeneration - multiple diseases fca05132   Salmonella infection fca05145   Toxoplasmosis fca05152   Tuberculosis fca05161   Hepatitis B fca05162   Measles fca05168   Herpes simplex virus 1 infection fca05169   Epstein-Barr virus infection fca05170   Human immunodeficiency virus 1 infection fca05200   Pathways in cancer fca05206   MicroRNAs in cancer fca05207   Chemical carcinogenesis - receptor activation fca05210   Colorectal cancer fca05215   Prostate cancer fca05222   Small cell lung cancer fca05226   Gastric cancer fca05417   Lipid and atherosclerosis fca05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     493934 (BCL2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     493934 (BCL2)    04630 JAK-STAT signaling pathway     493934 (BCL2)    04064 NF-kappa B signaling pathway     493934 (BCL2)    04066 HIF-1 signaling pathway     493934 (BCL2)    04071 Sphingolipid signaling pathway     493934 (BCL2)    04151 PI3K-Akt signaling pathway     493934 (BCL2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     493934 (BCL2)   09143 Cell growth and death    04210 Apoptosis     493934 (BCL2)    04215 Apoptosis - multiple species     493934 (BCL2)    04217 Necroptosis     493934 (BCL2)    04115 p53 signaling pathway     493934 (BCL2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     493934 (BCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     493934 (BCL2)   09152 Endocrine system    04915 Estrogen signaling pathway     493934 (BCL2)    04928 Parathyroid hormone synthesis, secretion and action     493934 (BCL2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     493934 (BCL2)   09156 Nervous system    04725 Cholinergic synapse     493934 (BCL2)    04722 Neurotrophin signaling pathway     493934 (BCL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     493934 (BCL2)    05206 MicroRNAs in cancer     493934 (BCL2)    05207 Chemical carcinogenesis - receptor activation     493934 (BCL2)   09162 Cancer: specific types    05210 Colorectal cancer     493934 (BCL2)    05226 Gastric cancer     493934 (BCL2)    05215 Prostate cancer     493934 (BCL2)    05222 Small cell lung cancer     493934 (BCL2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     493934 (BCL2)    05161 Hepatitis B     493934 (BCL2)    05162 Measles     493934 (BCL2)    05168 Herpes simplex virus 1 infection     493934 (BCL2)    05169 Epstein-Barr virus infection     493934 (BCL2)   09171 Infectious disease: bacterial    05132 Salmonella infection     493934 (BCL2)    05152 Tuberculosis     493934 (BCL2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     493934 (BCL2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     493934 (BCL2)    05022 Pathways of neurodegeneration - multiple diseases     493934 (BCL2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     493934 (BCL2)    05418 Fluid shear stress and atherosclerosis     493934 (BCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     493934 (BCL2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     493934 (BCL2)    01524 Platinum drug resistance     493934 (BCL2)    01522 Endocrine resistance     493934 (BCL2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:fca01009]     493934 (BCL2) Protein phosphatases and associated proteins [BR:fca01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      493934 (BCL2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  493934 NCBI-ProteinID:  NP_001009340 UniProt:  Q8I008 LinkDB All DBs Position D3:complement(80776548..80953959) Genome browser AA seq 235 aa AA seqDB search MAHAGRTGYDNREIVMKYIHYELPQRGYEWDAGDAGAAPPGAAPAPGIFSSQPGRTPAPA RTSPPPPPVAPAAAAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPF TARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVEGVNREMSPLVDNIALWMTEYLNRH LHTWIQDNGGWDAFVELYGPSMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK NT seq 708 nt NT seq  +upstreamnt  +downstreamnt atggcgcacgctgggagaacagggtatgataaccgggagatagtgatgaagtacatccac tatgagctgccgcagaggggctacgagtgggatgccggggacgcgggcgccgcgcccccg ggggccgcccccgcgccgggcatcttctcctcccagcccgggcgcacccctgcgcccgcc aggacctccccgccgccgcccccggtcgcccccgccgccgccgccgctgccgcgggccct gcgctcagccccgtgccacctgtggtccacctgaccctgcgccaggccggcgatgacttc tcccgtcgctaccgccgcgacttcgcggagatgtccagccagctgcacctgacacccttt accgcaaggggacgctttgccacggtggtggaggagctcttcagggatggcgtgaactgg gggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagggcgtcaaccga gagatgtcgcccctggtggacaacatcgccctgtggatgactgagtacctgaaccggcac ctgcacacctggatccaggataacggaggctgggatgcctttgtggaactgtacggcccc agcatgcagcctctgtttgatttctcctggctgtccctgaaggccctgctcagtctggcc ctggtgggggcttgcatcaccctgggtgcctatctgggccacaagtga

DBGET integrated database retrieval system