Felis catus (domestic cat): 493965 Help Entry 493965            CDS       T02385                                  Symbol IFNG Name (RefSeq) interferon gamma precursor   KO K04687   interferon gamma Organism fca  Felis catus (domestic cat) Pathway fca03050   Proteasome fca04060   Cytokine-cytokine receptor interaction fca04066   HIF-1 signaling pathway fca04217   Necroptosis fca04350   TGF-beta signaling pathway fca04380   Osteoclast differentiation fca04612   Antigen processing and presentation fca04630   JAK-STAT signaling pathway fca04650   Natural killer cell mediated cytotoxicity fca04657   IL-17 signaling pathway fca04658   Th1 and Th2 cell differentiation fca04659   Th17 cell differentiation fca04660   T cell receptor signaling pathway fca04940   Type I diabetes mellitus fca05140   Leishmaniasis fca05142   Chagas disease fca05143   African trypanosomiasis fca05144   Malaria fca05145   Toxoplasmosis fca05146   Amoebiasis fca05152   Tuberculosis fca05160   Hepatitis C fca05164   Influenza A fca05168   Herpes simplex virus 1 infection fca05200   Pathways in cancer fca05235   PD-L1 expression and PD-1 checkpoint pathway in cancer fca05321   Inflammatory bowel disease fca05322   Systemic lupus erythematosus fca05323   Rheumatoid arthritis fca05330   Allograft rejection fca05332   Graft-versus-host disease fca05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     493965 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     493965 (IFNG)    04630 JAK-STAT signaling pathway     493965 (IFNG)    04066 HIF-1 signaling pathway     493965 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     493965 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     493965 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     493965 (IFNG)    04612 Antigen processing and presentation     493965 (IFNG)    04660 T cell receptor signaling pathway     493965 (IFNG)    04658 Th1 and Th2 cell differentiation     493965 (IFNG)    04659 Th17 cell differentiation     493965 (IFNG)    04657 IL-17 signaling pathway     493965 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     493965 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     493965 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     493965 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     493965 (IFNG)    05164 Influenza A     493965 (IFNG)    05168 Herpes simplex virus 1 infection     493965 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     493965 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     493965 (IFNG)    05144 Malaria     493965 (IFNG)    05145 Toxoplasmosis     493965 (IFNG)    05140 Leishmaniasis     493965 (IFNG)    05142 Chagas disease     493965 (IFNG)    05143 African trypanosomiasis     493965 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     493965 (IFNG)    05323 Rheumatoid arthritis     493965 (IFNG)    05321 Inflammatory bowel disease     493965 (IFNG)    05330 Allograft rejection     493965 (IFNG)    05332 Graft-versus-host disease     493965 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     493965 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     493965 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:fca03051]     493965 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:fca04052]     493965 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:fca00536]     493965 (IFNG) Proteasome [BR:fca03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     493965 (IFNG) Cytokines and growth factors [BR:fca04052]  Cytokines   Interferons    493965 (IFNG) Glycosaminoglycan binding proteins [BR:fca00536]  Heparan sulfate / Heparin   Cytokines    493965 (IFNG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma Motif Other DBs NCBI-GeneID:  493965 NCBI-ProteinID:  NP_001009873 Ensembl:  ENSFCAG00000009014 UniProt:  P46402 A9UKW5 LinkDB All DBs Position B4:complement(95329479..95334070) Genome browser AA seq 167 aa AA seqDB search MNYTSFIFAFQLCIILCSSGYYCQAMFFKEIEELKGYFNASNPDVADGGSLFVDILKNWK EESDKTIIQSQIVSFYLKMFENLKDDDQRIQRSMDTIKEDMLDKLLNTSSSKRDDFLKLI QIPVNDLQVQRKAINELFKVMNDLSPRSNLRKRKRSQNLFRGRRASK NT seq 504 nt NT seq  +upstreamnt  +downstreamnt atgaattacacaagttttattttcgctttccagctttgcataattttgtgttcttctggt tattactgtcaggccatgttttttaaagaaatagaagagctaaagggatattttaatgca agtaatccagatgtagcagatggtgggtcgcttttcgtagacattttgaagaactggaaa gaggagagtgataaaacaataattcaaagccaaattgtctccttctacctgaaaatgttt gaaaacctgaaagatgatgaccagcgcattcaaaggagcatggacaccatcaaggaagac atgcttgataagttgttaaataccagctccagtaaacgggatgacttcctcaagctgatt caaatccctgtgaatgatctgcaggtccagcgcaaagcaataaatgaactcttcaaagtg atgaatgatctctcaccaagatctaacctgaggaagcggaaaaggagccagaatctgttt cgaggccgtagagcatcgaaataa

DBGET integrated database retrieval system