Felis catus (domestic cat): 751514 Help Entry 751514            CDS       T02385                                  Symbol IL4 Name (RefSeq) interleukin-4 precursor   KO K05430   interleukin 4 Organism fca  Felis catus (domestic cat) Pathway fca04060   Cytokine-cytokine receptor interaction fca04151   PI3K-Akt signaling pathway fca04630   JAK-STAT signaling pathway fca04640   Hematopoietic cell lineage fca04657   IL-17 signaling pathway fca04658   Th1 and Th2 cell differentiation fca04659   Th17 cell differentiation fca04660   T cell receptor signaling pathway fca04664   Fc epsilon RI signaling pathway fca04672   Intestinal immune network for IgA production fca05140   Leishmaniasis fca05200   Pathways in cancer fca05310   Asthma fca05320   Autoimmune thyroid disease fca05321   Inflammatory bowel disease fca05330   Allograft rejection Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     751514 (IL4)    04151 PI3K-Akt signaling pathway     751514 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     751514 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     751514 (IL4)    04660 T cell receptor signaling pathway     751514 (IL4)    04658 Th1 and Th2 cell differentiation     751514 (IL4)    04659 Th17 cell differentiation     751514 (IL4)    04657 IL-17 signaling pathway     751514 (IL4)    04664 Fc epsilon RI signaling pathway     751514 (IL4)    04672 Intestinal immune network for IgA production     751514 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     751514 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     751514 (IL4)   09163 Immune disease    05310 Asthma     751514 (IL4)    05320 Autoimmune thyroid disease     751514 (IL4)    05321 Inflammatory bowel disease     751514 (IL4)    05330 Allograft rejection     751514 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:fca04052]     751514 (IL4)    00536 Glycosaminoglycan binding proteins [BR:fca00536]     751514 (IL4) Cytokines and growth factors [BR:fca04052]  Cytokines   Interleukins    751514 (IL4) Glycosaminoglycan binding proteins [BR:fca00536]  Heparan sulfate / Heparin   Cytokines    751514 (IL4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 FAD_SOX Motif Other DBs NCBI-GeneID:  751514 NCBI-ProteinID:  NP_001036804 Ensembl:  ENSFCAG00000002490 UniProt:  P55030 A0A337RWU7 LinkDB All DBs Position A1:111778712..111787544 Genome browser AA seq 133 aa AA seqDB search MDLTSQLIPALVCLLAFTSTFVHGQNFNNTLKEIIKTLNILTARNDSCMELTVMDVLAAP KNTSDKEIFCRATTVLRQIYTHHNCSTKFLKGLDRNLSSMANRTCSVNEVKKCTLKDFLE RLKAIMQKKYSKH NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atggatctcacctcccaactgattccagctctggtctgcttactagcatttaccagcacc ttcgtccacggccagaacttcaataatacgttgaaagagatcatcaaaacgttgaacatc ctcacagcgagaaacgactcgtgcatggagctgaccgtcatggacgtcttggcagcccct aagaacacaagtgacaaggaaatcttctgcagagccacaaccgtgctccggcagatctat acacatcacaactgctccaccaaattcctcaaaggactcgacaggaacctcagcagcatg gcaaacaggacctgttctgtgaatgaagtcaagaagtgtacactgaaagacttcttggaa aggctaaaagcgatcatgcaaaagaaatactcaaagcactga

DBGET integrated database retrieval system