Folsomia candida: 110848901 Help Entry 110848901         CDS       T05043                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism fcd  Folsomia candida Pathway fcd03420   Nucleotide excision repair fcd04120   Ubiquitin mediated proteolysis fcd04141   Protein processing in endoplasmic reticulum fcd04310   Wnt signaling pathway fcd04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:fcd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110848901    04120 Ubiquitin mediated proteolysis     110848901   09124 Replication and repair    03420 Nucleotide excision repair     110848901  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     110848901    04350 TGF-beta signaling pathway     110848901  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:fcd04121]     110848901    03400 DNA repair and recombination proteins [BR:fcd03400]     110848901 Enzymes [BR:fcd01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      110848901 Ubiquitin system [BR:fcd04121]  Ubiquitin ligases (E3)   UBL E3 ligases    110848901   Multi subunit type E3    SCF complex     Ring finger protein      110848901    Cul2 complex      110848901    Cul3 complex      110848901    Cul4 complex      110848901    Cul7 complex      110848901    Cul8 complex      110848901    Cul9 complex      110848901 DNA repair and recombination proteins [BR:fcd03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       110848901     TCR (transcription coupled repair) factors      Cul4-CSA complex       110848901 SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  110848901 NCBI-ProteinID:  XP_021951943 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MANNGGGGQMEVDEEETQGPVSSSSSKDRKRFEVKKWSAVALWAWDIVVDNCAICRNHIM DLCIECQANQASASSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggcaaacaacggtggtggtggacagatggaagtagacgaggaggaaacccaaggaccc gtgtcgtcatcttcgtccaaagaccggaaacgattcgaagttaaaaagtggagtgccgtc gctctctgggcttgggatattgtcgtcgacaactgcgccatttgtcgaaatcacattatg gacctatgcatcgaatgtcaggctaatcaagcttccgcatcttcagaagagtgcacagtt gcttggggtgtttgtaaccacgcattccacttccactgcatttctcggtggctcaagact cggcaagtttgtcccttggataatcgagaatgggaatttcaaaagtacggtcattaa

DBGET integrated database retrieval system