Falco cherrug (Saker falcon): 102046283 Help Entry 102046283         CDS       T02911                                  Name (RefSeq) cystatin-like   KO K13899   cystatin-C Organism fch  Falco cherrug (Saker falcon) Brite KEGG Orthology (KO) [BR:fch00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:fch01002]     102046283   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fch04147]     102046283 Peptidases and inhibitors [BR:fch01002]  Peptidase inhibitors   Family I25: cystatin family    102046283 Exosome [BR:fch04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    102046283 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin Motif Other DBs NCBI-GeneID:  102046283 NCBI-ProteinID:  XP_014141218 LinkDB All DBs Position Unknown AA seq 77 aa AA seqDB search CSSRVVRVLSAQKQIVSGIKYLMEVEIGRTTCPKPAADLQSCAFHGAPEMAKHTVCNFTV YIVPWLNEIKLLSTSCQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt tgctccagccgggtggtgcgggtcctgagcgcccagaagcagattgtgtctggaatcaag tacttaatggaagttgagattggccggacaacttgcccaaagccagcagctgatctccag agctgcgctttccatggtgcgccggagatggctaagcacaccgtttgcaacttcacagtg tatattgttccttggctgaacgaaattaagctattgagcactagctgccaataa

DBGET integrated database retrieval system