Falco cherrug (Saker falcon): 102047657 Help Entry 102047657         CDS       T02911                                  Symbol IL6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism fch  Falco cherrug (Saker falcon) Pathway fch04060   Cytokine-cytokine receptor interaction fch04068   FoxO signaling pathway fch04218   Cellular senescence fch04620   Toll-like receptor signaling pathway fch04621   NOD-like receptor signaling pathway fch04623   Cytosolic DNA-sensing pathway fch04625   C-type lectin receptor signaling pathway fch04672   Intestinal immune network for IgA production fch05132   Salmonella infection fch05164   Influenza A fch05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:fch00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     102047657 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102047657 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     102047657 (IL6)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102047657 (IL6)    04621 NOD-like receptor signaling pathway     102047657 (IL6)    04623 Cytosolic DNA-sensing pathway     102047657 (IL6)    04625 C-type lectin receptor signaling pathway     102047657 (IL6)    04672 Intestinal immune network for IgA production     102047657 (IL6)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     102047657 (IL6)    05168 Herpes simplex virus 1 infection     102047657 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     102047657 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:fch04052]     102047657 (IL6) Cytokines and neuropeptides [BR:fch04052]  Cytokines   Interleukins    102047657 (IL6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL6 GCSF IL23 DUF5092 DUF5481 Motif Other DBs NCBI-GeneID:  102047657 NCBI-ProteinID:  XP_014140963 LinkDB All DBs Position Unknown AA seq 150 aa AA seqDB search MCEKFTVCGNSMEMLVQNNLNLPKVTEEDGCLLAGFDEEKCLRKISSGLYTFQTYLAHVQ ETFTSEKQNVESLCYSTEHLARTIRQMVINPDEVIIPDSATQESLRAKLKSDKIWIEKIT THLILRDFTSFMEKTVRAIRYLKNIRSFSV NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgtgcgagaagttcaccgtctgcgggaacagcatggaaatgctcgtccagaacaacctc aacctccccaaggtgacggaggaagacgggtgtctgctcgccggcttcgatgaggagaaa tgcttgaggaaaatctccagcggcctttatacctttcagacataccttgcacacgtacaa gaaacttttactagtgaaaagcaaaacgttgaatcgctgtgctatagtacagagcacctg gcacgcaccataaggcagatggtgatcaatcctgatgaagtgatcatcccggactcagct acccaggaatccctccgcgcaaagctgaagtccgataagatctggatagagaagatcacc acccacctcatcctccgagactttacttcatttatggagaaaacagtgagggccattcgc tatttgaaaaatatcaggagtttcagtgtttga

DBGET integrated database retrieval system