Falco cherrug (Saker falcon): 102047662 Help Entry 102047662         CDS       T02911                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism fch  Falco cherrug (Saker falcon) Pathway fch03050   Proteasome fch04060   Cytokine-cytokine receptor interaction fch04217   Necroptosis fch04350   TGF-beta signaling pathway fch05164   Influenza A fch05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:fch00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     102047662 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     102047662 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102047662 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102047662 (IFNG)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     102047662 (IFNG)    05168 Herpes simplex virus 1 infection     102047662 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:fch03051]     102047662 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:fch04052]     102047662 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:fch00536]     102047662 (IFNG) Proteasome [BR:fch03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     102047662 (IFNG) Cytokines and neuropeptides [BR:fch04052]  Cytokines   Interferons    102047662 (IFNG) Glycosaminoglycan binding proteins [BR:fch00536]  Heparan sulfate / Heparin   Cytokines    102047662 (IFNG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IFN-gamma ATG17_like DUF4422 Fib_alpha DUF948 TelA Spectrin_Anc-1 Motif Other DBs NCBI-GeneID:  102047662 NCBI-ProteinID:  XP_005431927 LinkDB All DBs Position Unknown AA seq 164 aa AA seqDB search MTCQTYSLFVLSVIMICFGRFGNSSILAQLENDIDQLKADFNSSNSDVADGGPIFVDKLT NWTERNEKRIILSQIVSMYLEMLEKTDKSKAHIRHISEELYTLKNSLPDGLKKMKDLMDL TKLQMSDLKIQRKAANELFSVLQKLEPSAPLKRKRSQFQKKCKC NT seq 495 nt NT seq  +upstreamnt  +downstreamnt atgacttgccagacctacagcttgtttgttctgtctgtcatcatgatttgttttggacgt tttggaaatagttccattcttgctcaacttgaaaatgatatagaccaactgaaagctgac tttaactcgagtaattcagatgtagctgatggtggacctatttttgtggacaaactgaca aactggacagagagaaatgaaaaaaggatcatcctgagccagattgtttccatgtacttg gaaatgcttgagaagactgacaagtcaaaggcgcacatcaggcacatatctgaggagctc tatactctgaaaaatagccttcctgatggcttaaagaagatgaaagacctcatggacctg acaaagcttcagatgagtgacttgaaaattcaacgcaaagctgcaaatgagctcttcagt gtcttacaaaagctggagccttcagctcctctcaaaaggaaaaggagccagtttcagaag aagtgcaaatgttaa

DBGET integrated database retrieval system