Formica exsecta (narrow-headed ant): 115233657 Help Entry 115233657         CDS       T07422                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism fex  Formica exsecta (narrow-headed ant) Pathway fex03420   Nucleotide excision repair fex04120   Ubiquitin mediated proteolysis fex04141   Protein processing in endoplasmic reticulum fex04310   Wnt signaling pathway fex04341   Hedgehog signaling pathway - fly fex04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:fex00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     115233657    04120 Ubiquitin mediated proteolysis     115233657   09124 Replication and repair    03420 Nucleotide excision repair     115233657  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     115233657    04341 Hedgehog signaling pathway - fly     115233657    04350 TGF-beta signaling pathway     115233657  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:fex04121]     115233657    03400 DNA repair and recombination proteins [BR:fex03400]     115233657 Enzymes [BR:fex01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      115233657 Ubiquitin system [BR:fex04121]  Ubiquitin ligases (E3)   UBL E3 ligases    115233657   Multi subunit type E3    SCF complex     Ring finger protein      115233657    Cul2 complex      115233657    Cul3 complex      115233657    Cul4 complex      115233657    Cul7 complex      115233657    Cul8 complex      115233657    Cul9 complex      115233657 DNA repair and recombination proteins [BR:fex03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       115233657     TCR (transcription coupled repair) factors      Cul4-CSA complex       115233657 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  115233657 NCBI-ProteinID:  XP_029660067 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MLQNLNMATTMEIDDDECDLPTSSSGKGEKKRFEVKKWNAVALWAWDIVVDNCAICRNHI MDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQK NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctccaaaatttaaatatggcgacaaccatggaaatcgacgacgacgagtgtgatttg ccaacctctagcagcggaaaaggcgagaagaagcgtttcgaagtaaagaaatggaatgca gtagcattatgggcttgggatattgttgtggacaactgtgctatatgtcgtaatcacatt atggatctttgcattgaatgccaagcaaaccaggcatctgccacaagcgaggagtgcaca gtggcctggggtgtatgcaatcacgcttttcatttccattgcatctcacgttggttgaaa acacggcaagtttgtccacttgacaatcgcgaatgggaatttcaaaagtaa

DBGET integrated database retrieval system