KEGG   Fulvia fulva: CLAFUR5_14164
Entry
CLAFUR5_14164     CDS       T08195                                 
Name
(RefSeq) Norsolorinic acid synthase
  KO
K15316  noranthrone synthase [EC:2.3.1.221]
Organism
ffu  Fulvia fulva
Pathway
ffu00254  Aflatoxin biosynthesis
ffu01100  Metabolic pathways
ffu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ffu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    CLAFUR5_14164
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:ffu01008]
    CLAFUR5_14164
Enzymes [BR:ffu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.221  noranthrone synthase
     CLAFUR5_14164
Polyketide biosynthesis proteins [BR:ffu01008]
 Polyketide synthase (PKS)
  Iterative type I PKS
   Fungal nonreducing PKS (NR-PKS)
    CLAFUR5_14164
SSDB
Motif
Pfam: ketoacyl-synt SAT Acyl_transf_1 Thioesterase Ketoacyl-synt_C PP-binding PS-DH KAsynt_C_assoc Thiolase_N Abhydrolase_6 Mbeg1-like Hydrolase_4
Other DBs
NCBI-GeneID: 71994042
NCBI-ProteinID: XP_047769572
LinkDB
Position
13:251167..258429
AA seq 2386 aa
MAHSNATRVLVFGDQTYDFVPKLRELFQVKDNPILTAFLEQSHYVVRAQMIQSLPPAEHK
AARTFDLADMLKKYVAGKLSPAFQTALSCITQLGVFMREFHDFTKPYPRHDSSYVLGICT
GSLAAAAVSSSSSLSELLPIAVQTALIAFRLGLCVTDMRDRLESATEDRTQPWSVVLFDT
NEQTAVQAIKDFCASNVLPKTKQPWITSASSKTTTVSGAPRILKKLVQEPALKDKKTRNI
PIYVPAHNPALFTPEDVKSILETTPVDTWSNYPAKLPFISSVSGKLAWADNYLAVIQLAL
NQCLLESIGWGHVETELPRLLKFRGAQNVLITPITTSTDRALSAALGSTIANIEVEKAST
GEAYAHRPGSGKSKLAIVSMSGRFPEAQSTDSFWDLLYKGLDVVKEVPKRRWDVTTHVDP
TGRARNKGATKWGCWLDFAGEFDPRFFSISPKEAPQMDPAQRMALMSTYEAMERGGIVPD
TTPSTQRNRIGVFHGVTSNDWMETNTAQNIDTYFITGGNRGFIPGRINFCFEFSGPSYTN
DTACSSSLAAIHLACNSLWHGDCDTAVAGGTNMIFTPDGHAGLDKGFFLSRTGNCKPFDD
KADGYCRAEGVGTVMIKRLEDALADGDPIIGTILDAKTNHSAMSDSMTRPFVPAQIDNME
ACLSTAGVDATSLDYIEMHGTGTQVGDAVEMESVLSVFAPNEQLRTKEQPLYVGSAKANI
GHGEGVSGVTSLIKVLLMFQNNTIPPHCGIKPGSRINHNYPDLAARNVHIAFEPKPFLRR
EGRARRVLINNFSAAGGNTALLIEDSPDRMPVQTQDPRTAHTVTVSGHVGKSLSNNLSLL
LTHLKKNPTASLPHLSYTTTARRWHHLHRVAVSGTSIADITAKLEKAVENKDGVNRPKAK
PSVFFAFTGQGSQYLGMGRQLYDSYPKFRAELQRYDRLAQSHGFPSFAHIFTTASGDVEQ
NLPIVVQLAITALQMALFNLLTSFGLKASAVVGHSLGEYAALYAAGVLSASDTIYLVGKR
AELLQERCQRGTHSMLACKASEWSLAEVTAGTDVEVACVNGPEDTVLSGTVEEVAGVQQV
LSQKGVKATMLKLPFAFHSAQVQPILEDFEHLASGATFEKPKLAVLSPLLGSVVEKEGVV
GPAYLARHCREAVRMVKALETAKEKGTISEKTIVIEIGPKPLLCGMIKNILGQSVTALPT
LKDKGPDVWTNLSTIFTTLYTGGLDVNWTAVHAPFEAAKTVIQLPDYGWDLKDYFIQYEG
DWVLHRHKIHCNCADEGKDVHDTSHYCPGKHTFVENVVVPGGAQAQKAIAAAPSDKPAKK
MSKLDPTKEAYPGIPITTTVHKVIEEKTEPLGAHFTVETDISRPDVNSIAQGHTVDDIPL
CTPSFYADIALQVGKYAMDRIRAGHPGAGAIDGRVDVTDLVVDKALIPHGKAPQLLRTTV
TMSWPPKMAATTRSAKVTFKTYTADGKLDTDHAYCTVRFTTDAQQKSLQKKVPEYKAAIE
SLRARMKKGELVHYNTKSGYKLMSSMAHFHPDYKLLNNLILNEAENEAVSVMNFSTCTDA
GTYAAHPAYVDAITQVGGFAMNAKDDTDIDKEVYVNHGWESFQVYKPLVKEKQYVVYSKM
AKDPKGDLVHGDTIVLDGDEVVAFFRGLSLRSVPRKALRAVLQSAMDKGIRQRGGKPGAA
KGAAAMPVAKAKPAPVVAPKASPVAAVPSTPKPAPPPAPKPAALKVVVKADNGKVDEALK
IISEESGIALDELTDDSNFTDMGVDSLSSMVITSRLREDLELYLAPDFALFADCPIVASL
REFLGGSAGASSAAEEFGEPTPVAETAPEPVPAPAPAPMQAAPKTVAPPKPVITTPAAPV
SSKVFDDALQIVSEESGIALDELTDDSNFTDMGVDSLSSMVITSRLREDLELELEPEWAL
FADCPTVASLRDFLRGSAAAVPANQDTPVDTTATEIEAPVPTEAPAYIPDASQGEVDEAV
REVLGDDPPYRPATQQPSTASLAANTEALDAALRIIAEESGVAAEDFADDTIFSDSGIDS
LCSMVISSRFREELELDLDSQFSLFVDLPTVAQLREYVTGPSSSADSDNSSVTSAPADIA
TPPHSDSGHSSDTEPDDEPTPTLKSDLTLTDTCRATNSVILQGMPRIASKILFLLPDGGG
SASSYSIIPKLRSDVAVVGINCPYARDPENMTCTHQAMMRSFVNEIKRRQPKGPYHLGGW
SSGGAFAYVTAETLINQGEEVASLFIFDAPVPQVMEKLPREFYEAVNFTESTVVGTVEPP
PYLIPHFMAVVDVMLDYKCHPLKTKKMPKVGLIWADSTVMKEEEAPKMKGMHFMIQKRTD
FGPDGWDKVCPGAKFDLVKAEDTNHFTLMTKARVYLVSELIERVMG
NT seq 7161 nt   +upstreamnt  +downstreamnt
atggcacactccaacgcgaccagagtgctggtcttcggtgaccagacctatgactttgtg
cccaagttgcgagaactgttccaggtcaaggataacccgatcctgactgccttcctggaa
cagtcccactatgtggtccgagcacagatgatccagagtctgcctcctgccgagcacaag
gcagctaggactttcgatctggcagacatgctgaagaagtatgtcgccggcaagctgagt
ccagccttccagacggctctcagctgtatcacacaactcggtgtcttcatgcgagagttc
catgacttcaccaagccttatccacgacacgatagcagctacgtgctgggtatctgcacc
ggctcgctggccgctgccgcagtcagctctagcagctccctctcggagctcctacccatt
gctgtccagacagctttgatcgccttccgcctcggtctctgtgtcacggacatgcgagat
cgtctcgaaagtgctacagaagaccgcactcagccatggtcagtggtattgttcgacaca
aacgagcagactgccgtacaggccatcaaagacttctgcgcctccaacgttctcccaaag
acgaagcaaccctggatcacatcggcctcctcgaagactaccaccgtcagcggagcaccg
cgcatactgaagaagctggtacaagagcctgcactcaaggacaagaagacacgaaacatc
cccatctacgtgccagcgcacaaccccgctctcttcacaccggaggatgtcaagtccatt
ctcgagacaacacctgtcgacacctggagcaactacccagccaagctgccattcatctcg
agcgtatccggcaagctcgcatgggcggataactacctcgcagtcatccagctcgccctc
aaccaatgcttacttgagagcatcggctggggccatgtcgagacggagctcccaagactt
ctcaagttccgcggcgcacagaacgtgctcatcactccaatcaccacctccaccgaccgt
gccctgtccgccgccctcggttccacaatcgccaacattgaggtcgagaaggcgtccacc
ggcgaagcttacgcccacagacccggctcgggcaagagcaagctcgccatcgtctcgatg
tctggacgcttccccgaagcgcagagcacagattccttctgggacttgctctacaagggt
ctcgacgtcgtgaaagaagtccccaagcgccgctgggacgtcaccacccacgtcgaccca
acaggccgtgcccgtaacaagggcgccaccaaatggggctgctggctcgactttgctgga
gaattcgatccccgcttcttcagcatttcccccaaagaggcaccgcagatggatcctgcg
caacgtatggcgctgatgtcgacgtatgaggcgatggagcggggtgggatcgtgccggat
acgacgccgtccacgcagaggaatcggattggggtgttccatggtgtgacgtctaatgat
tggatggagaccaacacggcgcagaatattgatacgtacttcattaccggcgggaatcgt
ggttttatccctggccggattaacttctgctttgagttttcgggacctagctacacgaac
gatacggcttgctcgagttcgctcgctgctatccatttggcttgcaactccctctggcat
ggcgactgcgatactgctgttgccggtgggacgaatatgatcttcacacctgatggtcat
gctgggcttgataaggggttcttcctgtcccgtaccggcaactgtaagcctttcgacgac
aaggctgatggctactgccgtgctgagggtgtcggtaccgtcatgatcaagagactcgaa
gacgctctcgcagatggcgacccgattattggaactatcctcgatgcgaagacgaaccac
tccgctatgagcgattccatgactcgtcctttcgtcccggctcagattgataacatggaa
gcttgtctgagcaccgctggcgttgatgctacttccctcgactacatcgagatgcacggg
actggtacgcaagtcggtgacgcagtcgagatggagtctgtcctctccgttttcgcgcca
aatgagcagttgcgcaccaaggagcagcctctatacgtcggctccgcgaaggccaatatt
ggccacggcgaaggtgtctctggtgtgacgagtctgatcaaggttctgctcatgttccaa
aacaacaccatcccacctcattgcggtatcaaacctggtagtaggatcaaccacaactac
ccagacctcgccgcgcggaatgtccacatcgccttcgagcctaagccgttcctgcgacgc
gagggcagggcgaggagggtgttgatcaacaacttcagcgccgcaggcggtaacactgct
ctcctcatcgaagattcgccagacaggatgccagtgcagacccaagacccgcgcacagcc
cacaccgtcacagtctccggccacgtcggcaagagtttgagcaataacctctccctcctt
ctcacccatctgaagaagaacccaacagcctcgctgccacacctctcctacaccaccaca
gcccgccgctggcaccacctccaccgcgtcgctgtctcgggcacttccatcgcggacatc
actgcgaagctggagaaagccgtcgagaacaaggacggtgtcaataggccgaaggctaag
ccttccgtcttcttcgccttcacaggtcaaggtagccagtatctcggcatgggaaggcaa
ctctacgactcgtaccctaaattccgcgctgagctccaacgctacgaccgtctagcgcaa
tcgcacggattcccgagcttcgcgcacattttcacgaccgcttcgggagatgttgagcag
aatttacctatcgtggttcagcttgcgattacggcgcttcaaatggcgctcttcaatctc
ctcacgtcctttggtctcaaggcctcggctgtggttggacactcactaggtgaatacgct
gccctctacgccgctggtgttttgtccgctagcgatacgatttatctggtcggtaagcga
gcggagctgcttcaagagcgatgccagaggggcacgcactccatgctcgcctgcaaggct
agcgagtggtctctcgcggaagttacggccgggacggacgttgaggtcgcgtgtgttaac
ggacccgaagataccgtgctgagcgggactgtggaggaggttgcgggcgtgcagcaagtt
ctaagccagaagggcgtgaaggcgacgatgttgaagttgccgttcgcgttccattccgcg
caggtgcagccgatcttggaggatttcgagcacctggcttctggcgcgacgtttgagaag
ccgaagcttgcggtgctgagtccgctattgggaagcgtggttgagaaggagggagtggtt
ggacctgcgtaccttgcgcgccattgtcgggaagcggtgaggatggttaaggccctcgag
acggcgaaggagaagggcacgatcagtgagaagactatcgtcattgaaattggaccgaag
ccgttgctttgtggaatgattaagaacatccttggccagagcgttacggcgttgcccacg
ctgaaggataagggtccggatgtctggacgaacttgtcgaccattttcacgacgctttat
actggaggtctcgatgttaactggactgcggtccatgctccgttcgaggctgcgaagacg
gtcattcagctccctgactatggctgggatttgaaggactatttcatccagtatgaaggt
gactgggtcctgcatcgacacaagatacactgcaattgcgcggatgagggtaaggatgtt
catgatacctcgcactactgcccaggcaagcataccttcgtcgagaatgttgtcgttcca
ggcggagctcaagcccagaaggctattgcggcagcaccgagcgataagcctgcgaagaag
atgtcgaaacttgatcctacgaaggaagcgtaccctggcattccaatcaccacgactgtg
cataaagtcattgaggagaagacggagcccctgggagcccacttcacagttgaaactgat
atctcccgccccgatgtcaacagcatagctcaaggccacactgttgacgacatccctctt
tgcaccccatcgttctacgcggacattgcgctccaggtaggcaaatatgccatggaccgt
atccgcgccggacatcctggtgctggcgctattgatggtagggtcgatgtgacggatctt
gtcgttgacaaggcgctcattccgcacgggaaggcgcctcaacttctgcgaacgaccgtg
acgatgagctggcctccaaaaatggcggctacgacacggtccgccaaggtgacgttcaag
acgtacaccgcagacggcaagttagatacggatcacgcatactgcaccgtccgcttcacc
accgacgcacagcaaaaatcactccagaagaaagtcccagagtacaaagccgccatcgaa
tcgctacgcgcccgtatgaagaagggcgaactagtccactacaacaccaaatccggctac
aaactcatgtcctccatggcccacttccaccccgactacaagctcctcaacaatctcatc
ctaaacgaagccgaaaacgaagccgtcagcgttatgaacttctccacctgcaccgacgca
ggaacctacgccgcccacccagcctacgtcgacgccatcacacaggtcggcggtttcgcg
atgaatgccaaggatgacaccgatattgataaggaggtgtatgtcaaccatggatgggag
tctttccaggtttataagccgttggtcaaggagaagcagtatgtggtgtactcgaagatg
gcgaaggatccgaagggagatcttgttcatggggacacgattgtgctggatggtgatgag
gtagttgcgttcttccggggtttgtcgctgcggagtgtcccacgcaaggcgttgagggct
gtgttgcagagtgcgatggataagggtattcggcaacgtggtggaaagcccggtgctgcc
aagggtgcagctgctatgccggtggcgaaggcgaagcctgctccggtcgtggcaccgaag
gcttcgccagtcgctgctgtaccatcgacaccgaagccggcaccaccgcctgccccgaag
cctgcggcgttgaaggttgtggtcaaggcagataatggcaaggttgacgaggcgctgaag
atcatctccgaggagagtggcattgccctggacgagttgacggatgatagtaacttcacg
gacatgggcgtcgacagcttaagctccatggtcattacatcccgtcttcgcgaggacttg
gagctgtatctcgctcctgactttgctctcttcgccgactgccctattgtcgctagtttg
agggagtttctgggtggatctgctggtgcatccagtgctgctgaggagtttggagagccc
acgcctgtcgccgaaacagctcctgaaccagtacctgcacctgcacctgcacctatgcag
gccgcgccaaagaccgttgctcctccaaagcctgtcatcaccactccggcggctccagtc
agcagcaaggtcttcgatgatgctcttcagatcgtctctgaggagagcggcattgctctc
gatgagcttactgatgatagcaacttcactgatatgggggtggacagcctgagctctatg
gtcatcactagtcggttgagagaagatcttgagcttgagcttgagcctgagtgggcactg
tttgcggattgtcctactgttgccagtctgagggactttcttcgaggttcagctgctgct
gttcctgctaaccaggatacgccagtcgacacgacggccactgagatcgaggctcctgtt
ccgactgaggccccagcctacatccccgacgcttctcagggtgaagtcgacgaagctgtt
agggaagttcttggagacgatcctccttaccgcccagcaactcaacaaccgtccaccgct
tcactagcagcgaacacagaagcccttgatgccgcccttcgcatcatcgccgaggagtct
ggagtcgcagctgaagacttcgccgacgacaccatcttctcagatagcggcatcgattcg
ctatgttccatggtcatctcctcgcgcttccgcgaagaacttgagcttgacctcgactcg
caattctccctcttcgtcgacctcccaaccgttgctcaactccgcgaatacgtcacagga
ccatccagcagtgctgactctgacaactcatctgtaacttcagcacccgctgacatcgct
acgccaccacactcagacagcggccactcttccgacaccgaaccagacgacgaacccacc
ccaaccctcaaaagcgatctaaccctgaccgacacctgccgcgccaccaactcggtcatc
ctccaaggcatgccgcgcatcgcctccaagatcctcttcctcctccccgacggcggcggc
agcgcatcctcctactccatcatccccaagctccgctccgacgtagcagtcgtcggcatc
aactgcccctacgcccgggaccccgagaacatgacctgtacgcaccaagccatgatgcga
agcttcgtcaacgagatcaagcgtcgccaaccaaagggaccctaccacctcggcggctgg
agcagcggaggcgcgtttgcgtacgtcactgctgagacactgatcaaccaaggcgaggaa
gtcgcatccctcttcatcttcgacgccccggtgccgcaagtaatggagaaactcccacga
gaattctacgaagccgtgaacttcaccgaatccaccgtcgtcggcaccgtggaaccgcct
ccatacctcatccctcacttcatggccgttgtagacgtcatgctcgactacaaatgccac
ccgctcaagaccaagaagatgccgaaggtggggctgatttgggctgatagtactgtgatg
aaggaggaggaggcgccgaagatgaaggggatgcatttcatgattcagaaacggactgat
tttgggcctgatggatgggataaagtgtgcccgggggcgaagtttgatcttgtcaaggcg
gaggatacgaatcattttacgcttatgacgaaggcgagggtttatttggttagtgagttg
attgagagggttatggggtag

DBGET integrated database retrieval system