KEGG   Fulvia fulva: CLAFUR5_14272
Entry
CLAFUR5_14272     CDS       T08195                                 
Name
(RefSeq) Versicolorin B synthase
  KO
K17646  5'-oxoaverantin cyclase / versicolorin B synthase [EC:4.2.1.142 4.2.1.143]
Organism
ffu  Fulvia fulva
Pathway
ffu00254  Aflatoxin biosynthesis
ffu01100  Metabolic pathways
ffu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ffu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    CLAFUR5_14272
Enzymes [BR:ffu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.142  5'-oxoaverantin cyclase
     CLAFUR5_14272
    4.2.1.143  versicolorin B synthase
     CLAFUR5_14272
SSDB
Motif
Pfam: GMC_oxred_N GMC_oxred_C Pyr_redox_3 Pyr_redox_2 DAO FAD_binding_2 NAD_binding_8 Lycopene_cycl HI0933_like NAD_binding_9 Thi4 Pyr_redox Trp_halogenase TrkA_N FAD_oxidored
Other DBs
NCBI-GeneID: 71994150
NCBI-ProteinID: XP_047769377
LinkDB
Position
13:complement(610404..612396)
AA seq 648 aa
MALSTLLTAAAMPVAGLFALAQQSSSFFDQIPVLGSMLNAGGVGTYDAQAAQHDGRIQAR
DLLSSHFGPIGWPHQSFDYVIVGGGTAGLAMAKRLSEEEGNSVALIEAGGFYEMDAGNAT
EVPMYLFNYFFDNGYMKNPLFDWYQYTEPQEGLHNREMFYMQGKTLGGSTARGAMLYHRG
SKGAYQKWAVQIGDDSYSWDKWLPHFQRGIKFSGPNTNPRPANATAVNDEKAWSATGGPV
HVAYPYLTNAISSWVDKALDAFGFTNVEGFSNGVLLGKSYITHTINPFTRRRETASSSYL
REALVESNNLNIYIRTLAKKVLFDENKKANAVEVQTDGFKWKIEAKKEVILSAGVMRSPQ
LLMVSGIGPKETLEKLDIPVLSDRPGVGQNLQDTIILGPTNPIRVESHSQLLGGKDTLPR
SIDDYNNHRTGLLTNPGQDFFAFEKHAKEGPGSLSKKTAADIDANFPADWPTYSFIALDD
TFVPQFNGKNYFSMSAALMTTFSRGYVSINSTDTLDNPIVDPKWLSDPRDQEMAVAAFRR
CRQFTQHEVLQDVIDGEELLPGKKYQTDEEVLGYIAETSDAYYAGVGTAAMGKKYDPKAV
LDSKARVLGVEGLRVVDASSFPFAIDGQPMGTVYALAEKIAADILAGN
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggcgcttagcaccctgctcacagcggcggcaatgcccgtcgctggcctcttcgccctc
gcacagcaatcttcttctttcttcgatcagatccccgtgctgggctcgatgctcaatgca
ggtggcgttggcacctacgatgcacaggcagcacagcatgatggccgtattcaggctcgt
gatctgctcagctcacatttcggccccattggctggcctcatcagtcatttgactatgtc
attgttggtggaggcacagctggtctggcaatggccaagaggctgtcggaagaggagggc
aactcggttgctctcattgaggccggtggcttctacgagatggatgctggtaatgcgact
gaggtgcccatgtacctcttcaactactttttcgacaatggatacatgaagaacccactt
ttcgactggtaccagtacaccgagccacaagagggtctccacaaccgtgagatgttctac
atgcaaggcaagacgctcggaggcagcactgctcgcggtgccatgctttaccaccgtggc
tcaaagggtgcctaccagaagtgggcagtccaaattggcgacgactcttacagctgggac
aagtggctgccacacttccagcgcggtatcaagttctctggccccaacaccaaccctcgt
ccggccaacgccacagctgtcaacgacgagaaggcatggtctgcaactggtggtccagtc
catgttgcatacccatacctcaccaacgccatctcttcgtgggttgacaaggctcttgat
gcatttggcttcaccaacgtcgagggcttctcgaacggtgtcctgcttggcaagtcgtac
atcacccacaccatcaacccattcactcgtcgccgtgagactgcttcatcctcctacctc
cgcgaggcactggtcgagagcaacaacctcaacatctacatccgcaccctcgccaagaag
gtcctcttcgacgagaacaagaaggccaacgccgtcgaagtccagaccgacggcttcaag
tggaagatcgaggccaagaaggaagtcatcctgtccgccggtgtgatgcgctctcctcaa
ctcctcatggtcagcggtatcggtcccaaggaaaccctcgagaagctcgacatcccagtc
ctctcagaccgcccaggcgtcggccaaaatctccaggacacaatcatcctcggacccacc
aaccccatccgcgtcgaatcccactcccagctcctcggtggaaaggacaccctcccccgt
tccatcgacgactacaacaaccaccgcaccggcctcctcaccaaccccggccaagacttc
ttcgccttcgaaaagcacgccaaggaaggacccggctcgctctccaagaagactgcagcg
gacatcgacgcgaacttcccagccgactggcccacttactctttcatcgccctcgacgac
accttcgtcccacagttcaacggcaagaattacttctccatgtccgccgctctcatgacg
acgttctcccgcggctacgtcagtatcaatagcaccgataccctcgacaaccccatcgtc
gaccccaagtggctctccgatcctcgcgaccaggaaatggccgtcgcggcgttccgtcgt
tgcagacaattcacacagcacgaagtcctgcaagacgtcatcgacggcgaggaactcctg
ccaggcaagaagtaccaaactgacgaggaagtgcttggctacatcgccgagactagtgat
gcatactacgccggtgtgggtactgcggccatgggaaagaaatatgaccccaaagcggtc
ttggactcgaaggcgagagtgttgggtgttgagggattgagagttgtggatgcgtcctcg
ttcccgttcgcgattgatggacagcctatgggcactgtgtatgcgctggctgagaagatt
gctgcggatattcttgcgggtaactag

DBGET integrated database retrieval system