KEGG   Fulmarus glacialis (Northern fulmar): 104076563
Entry
104076563         CDS       T08370                                 
Symbol
RCHY1
Name
(RefSeq) RING finger and CHY zinc finger domain-containing protein 1
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
fga  Fulmarus glacialis (Northern fulmar)
Pathway
fga04115  p53 signaling pathway
fga04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:fga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    104076563 (RCHY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    104076563 (RCHY1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:fga04121]
    104076563 (RCHY1)
Enzymes [BR:fga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     104076563 (RCHY1)
Ubiquitin system [BR:fga04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    104076563 (RCHY1)
SSDB
Motif
Pfam: zinc_ribbon_6 zf-RING_2 zf-C3HC4 zf-RING_5 zf-C3HC4_2 zf-RING_UBOX zf-RING_11 zf-RING_4 Prok-RING_4 zf-UDP zf-C3HC4_3 zf-rbx1 Sgf11
Other DBs
NCBI-GeneID: 104076563
NCBI-ProteinID: XP_009575774
LinkDB
Position
Unknown
AA seq 152 aa
IGPKEDFFHCSKCNLCLSLSLRGKHKCIENVSRQDCPICLEDIHTSRVGAHVLPCGHLLH
RTCYEDMLKEGYRCPLCMHSALDMTRYWRQLDDEVAQTPMPTEYQNMMVEILCNDCNARS
TVQFHLLGMKCKNCESYNTAQDGRCRLSLEEQ
NT seq 460 nt   +upstreamnt  +downstreamnt
gattggtccaaaggaggattttttccactgttcaaaatgcaatttatgcctgagcttgag
tcttcgaggaaagcacaagtgtattgaaaatgtctccaggcaggactgtccgatatgttt
ggaggatattcacacatctcgtgttggagctcacgttctgccgtgtggtcaccttcttca
cagaacatgttacgaggacatgctaaaggaaggttacaggtgtcctttgtgcatgcactc
ggctttagatatgacaaggtactggcgtcagctggatgacgaagtagcgcagactcctat
gcccacagagtatcagaacatgatggtggagatcctttgcaatgactgcaatgcccggtc
tacagtgcagttccatctcctaggcatgaagtgcaaaaactgtgagtcgtacaatactgc
ccaagatggaagatgccggctgtctttggaggagcagtga

DBGET integrated database retrieval system