Fulmarus glacialis (Northern fulmar): 104079903 Help Entry 104079903         CDS       T08370                                  Symbol RBX1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism fga  Fulmarus glacialis (Northern fulmar) Pathway fga03420   Nucleotide excision repair fga04110   Cell cycle fga04114   Oocyte meiosis fga04120   Ubiquitin mediated proteolysis fga04141   Protein processing in endoplasmic reticulum fga04310   Wnt signaling pathway fga04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:fga00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104079903 (RBX1)    04120 Ubiquitin mediated proteolysis     104079903 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     104079903 (RBX1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     104079903 (RBX1)    04350 TGF-beta signaling pathway     104079903 (RBX1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     104079903 (RBX1)    04114 Oocyte meiosis     104079903 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:fga04121]     104079903 (RBX1)    03400 DNA repair and recombination proteins [BR:fga03400]     104079903 (RBX1) Enzymes [BR:fga01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      104079903 (RBX1) Ubiquitin system [BR:fga04121]  Ubiquitin ligases (E3)   UBL E3 ligases    104079903 (RBX1)   Multi subunit type E3    SCF complex     Ring finger protein      104079903 (RBX1)    Cul2 complex      104079903 (RBX1)    Cul3 complex      104079903 (RBX1)    Cul4 complex      104079903 (RBX1)    Cul7 complex      104079903 (RBX1)    Cul8 complex      104079903 (RBX1)    Cul9 complex      104079903 (RBX1) DNA repair and recombination proteins [BR:fga03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       104079903 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       104079903 (RBX1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 PHD_NSD Motif Other DBs NCBI-GeneID:  104079903 NCBI-ProteinID:  XP_009580387 LinkDB All DBs Position Unknown AA seq 82 aa AA seqDB search WNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISR WLKTRQVCPLDNREWEFQKYGH NT seq 249 nt NT seq  +upstreamnt  +downstreamnt tggaacgcagtagctctgtgggcatgggacattgtggttgataactgtgccatttgcaga aaccatattatggatctatgcatagaatgtcaagcaaaccaagcatcagctacctctgaa gagtgcacagttgcatggggcgtctgcaatcatgctttccacttccactgcatctctcgc tggctcaaaactcgccaagtatgtccactagacaacagggaatgggagttccaaaagtat ggacactag

DBGET integrated database retrieval system