Fusarium musae: J7337_005231 Help Entry J7337_005231      CDS       T09538                                  Symbol RBX1 Name (RefSeq) RING-box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism fmu  Fusarium musae Pathway fmu03420   Nucleotide excision repair fmu04111   Cell cycle - yeast fmu04120   Ubiquitin mediated proteolysis fmu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:fmu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     J7337_005231 (RBX1)    04120 Ubiquitin mediated proteolysis     J7337_005231 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     J7337_005231 (RBX1)  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     J7337_005231 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:fmu04121]     J7337_005231 (RBX1)    03400 DNA repair and recombination proteins [BR:fmu03400]     J7337_005231 (RBX1) Enzymes [BR:fmu01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      J7337_005231 (RBX1) Ubiquitin system [BR:fmu04121]  Ubiquitin ligases (E3)   UBL E3 ligases    J7337_005231 (RBX1)   Multi subunit type E3    SCF complex     Ring finger protein      J7337_005231 (RBX1)    Cul2 complex      J7337_005231 (RBX1)    Cul3 complex      J7337_005231 (RBX1)    Cul4 complex      J7337_005231 (RBX1)    Cul7 complex      J7337_005231 (RBX1)    Cul8 complex      J7337_005231 (RBX1)    Cul9 complex      J7337_005231 (RBX1) DNA repair and recombination proteins [BR:fmu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       J7337_005231 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       J7337_005231 (RBX1) SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 Motif Other DBs NCBI-GeneID:  68313087 NCBI-ProteinID:  XP_044681404 UniProt:  A0A9P8DI18 LinkDB All DBs Position 4:complement(<911830..>912341) Genome browser AA seq 117 aa AA seqDB search MADVEMSDAPVAKKGEASGSKSVEGKKKFEVKKWNAVALWAWDIVVDNCAICRNHIMDLC IECQANQASATSEECTVAWGICNRQHAFHFHCISRWLKARSVCPLDNRDWEFQKYGR NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggccgacgttgagatgagcgatgcgcccgtcgctaagaagggcgaggcctccggcagc aagagcgtcgagggaaagaagaaattcgaggtcaagaagtggaatgcggtcgctctctgg gcatgggacatcgttgttgacaactgtgctatctgccgaaaccatatcatggatctatgc atcgaatgccaggcaaaccaagcatccgctacaagcgaagaatgcaccgtggcttgggga atatgcaacagacagcatgcgttccactttcactgcatttcgagatggctcaaggcccga tctgtttgtccattggacaatagggactgggagtttcagaagtacggccgataa

DBGET integrated database retrieval system