KEGG   Formosa sp. Hel3_A1_48: FORMA_18780
Entry
FORMA_18780       CDS       T04482                                 
Name
(GenBank) 3-oxoacyl-[acyl-carrier protein] reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
foh  Formosa sp. Hel3_A1_48
Pathway
foh00061  Fatty acid biosynthesis
foh00780  Biotin metabolism
foh01100  Metabolic pathways
foh01110  Biosynthesis of secondary metabolites
foh01212  Fatty acid metabolism
foh01240  Biosynthesis of cofactors
Module
foh_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:foh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    FORMA_18780
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    FORMA_18780
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    FORMA_18780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:foh01004]
    FORMA_18780
Enzymes [BR:foh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     FORMA_18780
Lipid biosynthesis proteins [BR:foh01004]
 Fatty acid synthase
  Component type
   FORMA_18780
SSDB
Motif
Pfam: adh_short_C2 adh_short KR SDR Epimerase THF_DHG_CYH_C 3HCDH_N HFX_2341_N HTH_MCM7
Other DBs
NCBI-ProteinID: AOR27026
LinkDB
Position
1979767..1980513
AA seq 248 aa
MKLLEGKTAIITGASRGIGKGIATVFAQQGANVAFTYSSSSEAAEALEKELSGLGVKVKA
YKSNAADFEAAQQLATDVLNDFGQIDILVNNAGITKDNLLMRMGEEDFDKVIEVNLKSVF
NMTKAVQRTMLKQRKGSIINMSSVVGVKGNAGQTNYAASKAGIIGFSKSVALELGSRNIR
SNVIAPGFIETEMTAKLDEATVAQWRAGIPLKRGGSPDDIANACVFLASDLSAYITGQTL
NVDGGMLT
NT seq 747 nt   +upstreamnt  +downstreamnt
atgaaattattagaaggaaaaaccgcaattatcacaggagctagtagaggcatagggaag
ggtattgctactgtttttgcacaacaaggcgctaatgtggcgtttacctacagttcctct
tcagaggctgctgaagctctcgagaaagagctttcaggcttaggtgtgaaagtgaaggca
tacaaaagcaatgctgctgattttgaagccgcacagcaactcgctactgatgttctaaac
gattttgggcaaattgatattttagtcaacaatgcaggcatcactaaagacaacctcttg
atgcgtatgggcgaagaggattttgataaggtcattgaagtgaacctaaaatcggtattc
aatatgaccaaggctgtacaacgtactatgctgaaacaacgcaaaggatccatcatcaat
atgagttctgttgtgggggtgaaagggaatgctggacaaaccaactatgcagcttctaaa
gctggaattataggattttctaaatctgttgcactagaattgggctcacgaaacatccgc
agcaatgtaatcgcaccaggattcattgaaactgaaatgaccgccaagctcgacgaagct
accgtagcgcaatggcgcgcagggattccactaaaacgtggaggatcaccagatgatatt
gccaatgcatgtgtctttttggcaagtgatctgtctgcctatattactggacaaacgcta
aatgttgacggcggtatgctcacataa

DBGET integrated database retrieval system