Falco peregrinus (peregrine falcon): 101924809 Help Entry 101924809         CDS       T02856                                  Symbol TMEM258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism fpg  Falco peregrinus (peregrine falcon) Pathway fpg00510   N-Glycan biosynthesis fpg00513   Various types of N-glycan biosynthesis fpg04141   Protein processing in endoplasmic reticulum Module fpg_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:fpg00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     101924809 (TMEM258)    00513 Various types of N-glycan biosynthesis     101924809 (TMEM258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101924809 (TMEM258) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  101924809 NCBI-ProteinID:  XP_005243406 LinkDB All DBs Position Un AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagttggaggcgatgagcaggtacaccagcccggtgaacccggctgtcttcccgcac ctcaccgtggtgctcctggccatcggcatgttcttcaccgcctggttcttcgtctacgag gtgacctctaccaagtacacgcgggacatctacaaggagctgttgatctccttggtggcc tcgcttttcatgggctttggcgttctcttcctgctgctgtgggtcggtatctacgtctga

DBGET integrated database retrieval system