Candidatus Francisella endociliophora: LO80_07780 Help Entry LO80_07780        CDS       T03403                                  Name (GenBank) hypothetical protein   KO K07260   zinc D-Ala-D-Ala carboxypeptidase [EC:3.4.17.14] Organism frf  Candidatus Francisella endociliophora Pathway frf00550   Peptidoglycan biosynthesis frf01100   Metabolic pathways frf01502   Vancomycin resistance frf02020   Two-component system Brite KEGG Orthology (KO) [BR:frf00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00550 Peptidoglycan biosynthesis     LO80_07780  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     LO80_07780  09160 Human Diseases   09175 Drug resistance: antimicrobial    01502 Vancomycin resistance     LO80_07780  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:frf01002]     LO80_07780    01011 Peptidoglycan biosynthesis and degradation proteins [BR:frf01011]     LO80_07780   09183 Protein families: signaling and cellular processes    01504 Antimicrobial resistance genes [BR:frf01504]     LO80_07780 Enzymes [BR:frf01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.17  Metallocarboxypeptidases     3.4.17.14  zinc D-Ala-D-Ala carboxypeptidase      LO80_07780 Peptidases and inhibitors [BR:frf01002]  Metallo peptidases   Family M15: zinc D-Ala-D-Ala carboxypeptidase family    LO80_07780 Peptidoglycan biosynthesis and degradation proteins [BR:frf01011]  Peptidoglycan biosynthesis and degradation   Carboxypeptidase    LO80_07780 Antimicrobial resistance genes [BR:frf01504]  Gene sets   Vancomycin resistance modules    Vancomycin resistance, D-Ala-D-Lac type [MD:M00651]     LO80_07780 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  VanY YjjI-like Motif Other DBs NCBI-ProteinID:  AIT09879 UniProt:  A0A097EQN1 LinkDB All DBs Position complement(1575472..1575714) Genome browser AA seq 80 aa AA seqDB search MKNLIETTKLDKTIFQRPKFEEVIKEDLIFWGQDVLHRDQFIHKSAYIPLKNMIKMAAKD NIILEVLSIFRSYKYQENLI NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgaaaaatttaattgaaacaacaaaacttgacaagacaatatttcaaagacccaaattt gaagaggtcataaaagaagaccttattttttggggccaagatgtactacatagagatcag tttatacataaatctgcttatatccccttaaaaaatatgattaaaatggctgcaaaagat aatattattttagaggtgttatcgatatttagatcatataaatatcaagaaaatctaatt tag

DBGET integrated database retrieval system