Fragaria vesca (woodland strawberry): 101298929 Help Entry 101298929         CDS       T02666                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism fve  Fragaria vesca (woodland strawberry) Pathway fve00510   N-Glycan biosynthesis fve00513   Various types of N-glycan biosynthesis fve04141   Protein processing in endoplasmic reticulum Module fve_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:fve00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     101298929    00513 Various types of N-glycan biosynthesis     101298929  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101298929 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 YLATT Motif Other DBs NCBI-GeneID:  101298929 NCBI-ProteinID:  XP_004287562 LinkDB All DBs Position LG1:complement(6172499..6173844) Genome browser AA seq 76 aa AA seqDB search MAPKPITSPVPDAWYPTLAVVMLSLGLLFTASFFIYEATSSRKTRSLAKELTTGTVASLF LGFGSLFLLLASGVYV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggctccgaagcccatcaccagtcccgtgccggacgcgtggtacccaaccctagccgtc gtcatgctctccctcggcctcctcttcaccgcttccttcttcatctatgaagcaacctcg tccaggaaaacccgcagtcttgctaaggagcttactacgggaactgtggcctctctcttc ttgggttttggatccttgttcttgctgcttgcttcgggtgtttatgtctaa

DBGET integrated database retrieval system