Fragaria vesca (woodland strawberry): 101302106 Help Entry 101302106         CDS       T02666                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism fve  Fragaria vesca (woodland strawberry) Pathway fve03420   Nucleotide excision repair fve04120   Ubiquitin mediated proteolysis fve04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:fve00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101302106    04120 Ubiquitin mediated proteolysis     101302106   09124 Replication and repair    03420 Nucleotide excision repair     101302106  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:fve04121]     101302106    03400 DNA repair and recombination proteins [BR:fve03400]     101302106 Enzymes [BR:fve01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      101302106 Ubiquitin system [BR:fve04121]  Ubiquitin ligases (E3)   UBL E3 ligases    101302106   Multi subunit type E3    SCF complex     Ring finger protein      101302106    Cul2 complex      101302106    Cul3 complex      101302106    Cul4 complex      101302106    Cul7 complex      101302106    Cul8 complex      101302106    Cul9 complex      101302106 DNA repair and recombination proteins [BR:fve03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       101302106     TCR (transcription coupled repair) factors      Cul4-CSA complex       101302106 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  101302106 NCBI-ProteinID:  XP_004306867 LinkDB All DBs Position LG7:complement(6084392..6087585) Genome browser AA seq 117 aa AA seqDB search MATLDSDVPMVPAGEGSSGAGSSSVKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMD LCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggcgacattggattccgacgtgccgatggttccggcaggcgagggctccagcggcgct ggctcgtcttcggtgaagaagccgaagcgattcgaaatcaagaagtggaatgctgtggct ctctgggcttgggatattgttgtggataattgtgctatatgccgaaaccatatcatggat ctttgcattgagtgccaagcgaaccaggcaagcgcaacaagcgaggagtgcacagttgct tggggtgtttgtaaccatgcatttcactttcactgcattagtagatggctcaagacccgc caagtgtgcccattagataacagtgagtgggagtttcagaagtatggtcattag

DBGET integrated database retrieval system