Fragaria vesca (woodland strawberry): 101307444 Help Entry 101307444         CDS       T02666                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism fve  Fragaria vesca (woodland strawberry) Pathway fve03420   Nucleotide excision repair fve04120   Ubiquitin mediated proteolysis fve04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:fve00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101307444    04120 Ubiquitin mediated proteolysis     101307444   09124 Replication and repair    03420 Nucleotide excision repair     101307444  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:fve04121]     101307444    03400 DNA repair and recombination proteins [BR:fve03400]     101307444 Enzymes [BR:fve01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      101307444 Ubiquitin system [BR:fve04121]  Ubiquitin ligases (E3)   UBL E3 ligases    101307444   Multi subunit type E3    SCF complex     Ring finger protein      101307444    Cul2 complex      101307444    Cul3 complex      101307444    Cul4 complex      101307444    Cul7 complex      101307444    Cul8 complex      101307444    Cul9 complex      101307444 DNA repair and recombination proteins [BR:fve03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       101307444     TCR (transcription coupled repair) factors      Cul4-CSA complex       101307444 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_16 Motif Other DBs NCBI-GeneID:  101307444 NCBI-ProteinID:  XP_004308610 LinkDB All DBs Position LG7:complement(10967380..10967715) Genome browser AA seq 119 aa AA seqDB search MTTDSDVTMVDVIGGVAGAGVGPSKKKTDKRFEMKKWSAVSMWAWDIVVENCAICRNHIM ELCIECQANQQSVTSDECTVAWGSCNHAFHFHCISRWLKNRQVCPLDNSEWEFQKYGNS NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgacaactgactctgacgtgacgatggtggacgtgatcggtggtgttgcaggtgcaggt gttggtccttcgaagaagaagaccgacaagcgatttgaaatgaagaagtggagcgcagtg agtatgtgggcgtgggatattgtggtggagaactgcgccatctgcaggaaccatataatg gagctgtgcatagagtgccaagccaaccagcagagtgtgacgagcgacgagtgcacggtg gcttggggaagttgcaaccatgccttccacttccactgcattagccgatggctcaagaat cgtcaggtctgtcccttggacaacagcgagtgggagtttcagaagtatggtaatagctaa

DBGET integrated database retrieval system