Fusarium venenatum: FVRRES_02914 Help Entry FVRRES_02914      CDS       T09539                                  Name (RefSeq) uncharacterized protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism fvn  Fusarium venenatum Pathway fvn03420   Nucleotide excision repair fvn04111   Cell cycle - yeast fvn04120   Ubiquitin mediated proteolysis fvn04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:fvn00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     FVRRES_02914    04120 Ubiquitin mediated proteolysis     FVRRES_02914   09124 Replication and repair    03420 Nucleotide excision repair     FVRRES_02914  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     FVRRES_02914  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:fvn04121]     FVRRES_02914    03400 DNA repair and recombination proteins [BR:fvn03400]     FVRRES_02914 Enzymes [BR:fvn01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      FVRRES_02914 Ubiquitin system [BR:fvn04121]  Ubiquitin ligases (E3)   UBL E3 ligases    FVRRES_02914   Multi subunit type E3    SCF complex     Ring finger protein      FVRRES_02914    Cul2 complex      FVRRES_02914    Cul3 complex      FVRRES_02914    Cul4 complex      FVRRES_02914    Cul7 complex      FVRRES_02914    Cul8 complex      FVRRES_02914    Cul9 complex      FVRRES_02914 DNA repair and recombination proteins [BR:fvn03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       FVRRES_02914     TCR (transcription coupled repair) factors      Cul4-CSA complex       FVRRES_02914 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  37254555 NCBI-ProteinID:  XP_025590119 UniProt:  A0A2L2T6H3 LinkDB All DBs Position I:complement(<8037411..>8037925) Genome browser AA seq 115 aa AA seqDB search MADVEMSDAPVAKKAEGSNTKSVEGKKKFEVKKWNAVALWAWDIVVDNCAICRNHIMDLC IECQANQASATSEECTVAWGICNHAFHFHCISRWLKARSVCPLDNRDWEFQKYGR NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggctgatgttgagatgagtgatgcgcccgtcgccaaaaaggccgagggctccaacacc aagagcgttgagggcaagaagaagttcgaggttaagaagtggaacgcagtagctctgtgg gcatgggacattgtggtcgacaactgtgctatctgccgtaatcacatcatggacctgtgt atcgaatgccaggcaaaccaagcatccgctactagtgaagaatgcaccgtggcctggggt atctgcaaccatgcattccacttccattgcatttcgcgatggttgaaggcccgatccgtt tgtcccttggacaatagggactgggagttccagaagtacggacgatag

DBGET integrated database retrieval system