Fusarium verticillioides: FVEG_08960 Help Entry FVEG_08960        CDS       T04869                                  Name (RefSeq) small nuclear ribonucleoprotein   KO K12622   U6 snRNA-associated Sm-like protein LSm3 Organism fvr  Fusarium verticillioides Pathway fvr03018   RNA degradation fvr03040   Spliceosome Brite KEGG Orthology (KO) [BR:fvr00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     FVEG_08960   09123 Folding, sorting and degradation    03018 RNA degradation     FVEG_08960  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:fvr03019]     FVEG_08960    03041 Spliceosome [BR:fvr03041]     FVEG_08960 Messenger RNA biogenesis [BR:fvr03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      FVEG_08960   mRNA degradation factors    5'-3' decay     Lsm complex      FVEG_08960 Spliceosome [BR:fvr03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     FVEG_08960  Complex C   U2 snRNP components     FVEG_08960 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM Motif Other DBs NCBI-GeneID:  30066652 NCBI-ProteinID:  XP_018755611 UniProt:  W7MPA1 LinkDB All DBs Position 5:complement(2826951..2827968) Genome browser AA seq 96 aa AA seqDB search MADTGEEPHHVSEPLDLVRLLLNEVVFVKLRGDRELKGKLHAYDSHCNLVLGEVEETIYT VDEDDDDEELKTISRKSEMLFVRGDSVVLISPGVPF NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggctgacacaggcgaagagccacatcacgtttcggagcctctcgaccttgttcgactc cttctcaacgaggttgtctttgtcaagcttcgaggagaccgtgagctcaaggggaagcta cacgcttacgacagtcactgtaatctggtattgggagaagtcgaggagaccatctacact gtggatgaggacgatgacgatgaagaactcaagactatcagccggaaatccgagatgctg tttgtgagaggcgatagtgtcgtccttatctcacctggggttccgttctag

DBGET integrated database retrieval system