KEGG   Candidatus Formimonas warabiya: DCMF_08820
Entry
DCMF_08820        CDS       T07208                                 
Name
(GenBank) hypothetical protein
  KO
K25221  [methyl-Co(III) glycine betaine-specific corrinoid protein]---tetrahydrofolate methyltransferase [EC:2.1.1.378]
Organism
fwa  Candidatus Formimonas warabiya
Pathway
fwa00670  One carbon pool by folate
fwa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fwa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    DCMF_08820
Enzymes [BR:fwa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.378  [methyl-Co(III) glycine betaine-specific corrinoid protein]---tetrahydrofolate methyltransferase
     DCMF_08820
SSDB
Motif
Pfam: MtrH
Other DBs
NCBI-ProteinID: ATW24862
UniProt: A0A3G1KQV8
LinkDB
Position
complement(1873319..1874227)
AA seq 302 aa
MHKFLAPQKTITIGEITLGGQPGQYPTVLIGSLFYRGHQIVTDHQKGEFDRDRAAELLRT
DQEWSIKTGLPRMIDVVGETVEALEKYVHFVAEQTGDPILVDSPVEKVRLEVMKSLRQSK
IKNQLIYNSLDIGAGAQEINMLGELGVKNCVLMVFNSRSIKPFDRSKLLTKEQNILFRLA
EAGVENILLDTGVLDLPSIGWSALAIADLKEKYGLVTGCAPSNALYMWKRTKQLEKEAFQ
AAGSVAMSLPVAYGADFIFYGPMVNASWVYAGVSMMDAVGAFTVKEYGVRPLTSQTPLLK
IF
NT seq 909 nt   +upstreamnt  +downstreamnt
atgcacaaatttttggcaccgcaaaaaactatcaccatcggtgagatcaccctgggcggg
caacccggccaataccctactgttttaatcggcagcctgttctaccggggacatcagatt
gtaaccgatcaccaaaaaggagagtttgaccgggatcgggctgcggaactgctccggaca
gatcaggaatggtccatcaaaaccggtttgccccggatgattgatgtggtaggggaaacg
gtagaagccttggaaaagtatgtacactttgtggctgagcagaccggtgaccctatcctg
gtggattcccctgtcgagaaagtccgcctggaagtgatgaaaagcctaaggcaaagcaaa
atcaagaaccagctcatctataactccctggatatcggagccggggcccaggaaataaat
atgctgggagaactgggtgtaaaaaactgcgtgctgatggtctttaacagcaggagtatc
aagccttttgacagatctaagctgttaactaaagagcaaaacatcttattcaggctggcg
gaggcaggagtggaaaatattttattggacacaggcgtgctggatttgcccagtatcggc
tggtccgccttagcgattgccgatttaaaagaaaaatatggcctggttaccggctgcgct
ccttccaacgctttatacatgtggaaaaggaccaaacaactggaaaaggaagcttttcaa
gcggccggctccgtagccatgagtctgccggtggcctatggggcggattttatcttttac
ggtcccatggtaaacgcttcctgggtatatgccggcgtgagcatgatggatgccgtcggt
gcttttaccgtcaaagagtatggggtaaggcccctgacttctcagaccccgttgctgaaa
attttctaa

DBGET integrated database retrieval system