Gymnodraco acuticeps: 117534788 Help Entry 117534788         CDS       T09661                                  Symbol rbx1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism gacu  Gymnodraco acuticeps Pathway gacu03420   Nucleotide excision repair gacu04110   Cell cycle gacu04114   Oocyte meiosis gacu04120   Ubiquitin mediated proteolysis gacu04141   Protein processing in endoplasmic reticulum gacu04310   Wnt signaling pathway gacu04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:gacu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     117534788 (rbx1)    04120 Ubiquitin mediated proteolysis     117534788 (rbx1)   09124 Replication and repair    03420 Nucleotide excision repair     117534788 (rbx1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     117534788 (rbx1)    04350 TGF-beta signaling pathway     117534788 (rbx1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     117534788 (rbx1)    04114 Oocyte meiosis     117534788 (rbx1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:gacu04121]     117534788 (rbx1)    03400 DNA repair and recombination proteins [BR:gacu03400]     117534788 (rbx1) Enzymes [BR:gacu01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      117534788 (rbx1) Ubiquitin system [BR:gacu04121]  Ubiquitin ligases (E3)   UBL E3 ligases    117534788 (rbx1)   Multi subunit type E3    SCF complex     Ring finger protein      117534788 (rbx1)    Cul2 complex      117534788 (rbx1)    Cul3 complex      117534788 (rbx1)    Cul4 complex      117534788 (rbx1)    Cul7 complex      117534788 (rbx1)    Cul8 complex      117534788 (rbx1)    Cul9 complex      117534788 (rbx1) DNA repair and recombination proteins [BR:gacu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       117534788 (rbx1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       117534788 (rbx1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  117534788 NCBI-ProteinID:  XP_034054904 UniProt:  A0A6P8SVC8 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MAAAMDVDTPTGTNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcagcagctatggatgttgatacgccgaccggcactaacagtggggctagcaagaag cgatttgaagtcaaaaagtggaatgcagtggcgctgtgggcctgggacattgtggtggat aactgtgccatctgtaggaaccacatcatggatctctgtatagagtgccaggccaaccaa gcttcagcaacttctgaggagtgcactgtagcctggggtgtctgcaatcatgctttccat ttccactgtatttcccgctggctgaaaaccagacaggtgtgccctctggacaacagggag tgggagtttcagaaatacggacactag

DBGET integrated database retrieval system