Gambusia affinis (western mosquitofish): 122835708 Help Entry 122835708         CDS       T07758                                  Symbol tmem258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism gaf  Gambusia affinis (western mosquitofish) Pathway gaf00510   N-Glycan biosynthesis gaf00513   Various types of N-glycan biosynthesis gaf04141   Protein processing in endoplasmic reticulum Module gaf_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:gaf00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     122835708 (tmem258)    00513 Various types of N-glycan biosynthesis     122835708 (tmem258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     122835708 (tmem258) SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Motif Other DBs NCBI-GeneID:  122835708 NCBI-ProteinID:  XP_043980913 LinkDB All DBs Position LG08:7463951..7465536 Genome browser AA seq 79 aa AA seqDB search MELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDVYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaactagaggccatgaccaggtacaccagcccggtgaacccagcggtgttcccccac ctcactgtggtcctactggccatcggaatgttcttcacagcctggttcttcgtttatgaa gtaacatcaacaaaatacacaagggacgtctacaaggagctgcttatctcactggtggct tcactttttatgggctttggcgtgcttttcttactgctgtgggtcggcatctacgtatga

DBGET integrated database retrieval system