Gambusia affinis (western mosquitofish): 122838513 Help Entry 122838513         CDS       T07758                                  Symbol pole4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism gaf  Gambusia affinis (western mosquitofish) Pathway gaf03030   DNA replication gaf03410   Base excision repair gaf03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:gaf00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     122838513 (pole4)    03410 Base excision repair     122838513 (pole4)    03420 Nucleotide excision repair     122838513 (pole4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:gaf03032]     122838513 (pole4)    03400 DNA repair and recombination proteins [BR:gaf03400]     122838513 (pole4) Enzymes [BR:gaf01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      122838513 (pole4) DNA replication proteins [BR:gaf03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     122838513 (pole4) DNA repair and recombination proteins [BR:gaf03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       122838513 (pole4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TAF TFIID-31kDa Motif Other DBs NCBI-GeneID:  122838513 NCBI-ProteinID:  XP_043985148 LinkDB All DBs Position LG10:complement(13481049..13483302) Genome browser AA seq 129 aa AA seqDB search MAATVEAPFPAEQDSARSGTEEENRGAEVEEKSQQQQTGSSGPAVPHSRLSKLPLARIKA LMKTDPDVSLASQESVFIIAKATELFVEMIAKDALVYAQQGKRKTLQRKDLDNAIEAIDE FAFLEGTLD NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atggcagctactgtagaagcgcctttcccagcggagcaggactctgcgcgtagcgggact gaagaggagaaccgcggggcggaggtggaggagaagagccagcagcagcagacaggctcc tccgggcccgccgtgcctcacagccgcctgtccaaactcccgctggcccgcatcaaagct ctgatgaagaccgacccagacgtgtccctcgccagccaagagtccgtgttcatcatcgct aaagccacggaattgtttgttgagatgattgccaaagatgctcttgtgtacgcccagcaa ggaaagaggaaaacattacaaagaaaagacttggacaatgctatcgaggccatagatgag tttgctttcctagaaggtacgctagattaa

DBGET integrated database retrieval system